Gene Information

Name : cg0768 (cg0768)
Accession : YP_224957.1
Strain : Corynebacterium glutamicum ATCC 13032
Genome accession: NC_006958
Putative virulence/resistance : Virulence
Product : ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1120
EC number : -
Position : 682510 - 683319 bp
Length : 810 bp
Strand : -
Note : -

DNA sequence :
GTGACCACCAACCATCAACTATCCGCCGAAGAAATTTCCCTGGCGTACGGCGAGCGCACCATCATCGATTCGCTCAGCGT
CGACATCGTCCCCGGCAAAATCACCTCCATCGTCGGCCCCAACGGATGCGGCAAATCAACGCTGCTGCGCGCCTTTGCGC
GCCTCCTTAAACCTAGCGCCGGGCAAGCGCTTATCGACGCCCACCCCCTTCCTTCACTGCCAGGCAAAGAACTAGCTCGC
ATGCTCGGGCTGTTACCGCAATCCCCCACCGCACCTGAAGGCATCGTCGTCGCCGACCTCGTGGGCCGCGGCCGCCACCC
CCACCAAGGACTCATGGGCAGATGGTCCACACGCGACTACGAAGTAGTGGCCCAAGCATTGGAAATGACCAACACCACCG
AGCTTGCCGAACGCCCCATCGACGAACTCTCCGGCGGCCAACGCCAACGCGTCTGGATCGCCATGGCCCTTGCCCAAGAA
ACAGACATCCTGCTTCTTGATGAACCCACCACCTACCTCGACATCGCCAACCAGCTCGAAGTGCTTGATCTCCTCACTGA
CCTCAACCACAACCACGGCACCACCATCGTCATGGTGCTCCACGAATTGGGACTTGCCGCACGTTACTCTGACCACCTCA
TCGCCATGAACGCCGGAAAAATCTACGCCCAAGGCACCCCCACCAACGTCATCACCGAAACCATGATGAGCGAGGTCTTC
CACACCGACGCCCGCATTATCGCCGACCCAGTCTCCGGCGCACCACTGGTCATGCCCATGGGACGACACCACATCACCGC
ACTTCACTAG

Protein sequence :
MTTNHQLSAEEISLAYGERTIIDSLSVDIVPGKITSIVGPNGCGKSTLLRAFARLLKPSAGQALIDAHPLPSLPGKELAR
MLGLLPQSPTAPEGIVVADLVGRGRHPHQGLMGRWSTRDYEVVAQALEMTNTTELAERPIDELSGGQRQRVWIAMALAQE
TDILLLDEPTTYLDIANQLEVLDLLTDLNHNHGTTIVMVLHELGLAARYSDHLIAMNAGKIYAQGTPTNVITETMMSEVF
HTDARIIADPVSGAPLVMPMGRHHITALH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iusE YP_005143742.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 5e-68 52
SPN23F_09560 YP_002510939.1 ferric siderophore ABC transporter ATP-binding protein Virulence PPI-1 Protein 7e-67 47
SP_1035 NP_345510.1 iron-compound ABC transporter ATP-binding protein Not tested PPI-1 Protein 7e-67 47
fecE AAL08451.1 ATP-binding protein FecE Virulence SRL Protein 3e-56 47
fagC YP_005680307.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 3e-58 46
fagC YP_003782430.1 ABC transporter ATP-binding protein Not tested PiCp 1 Protein 3e-58 46
fagC YP_005682397.1 ATP binding cytoplasmic membrane protein Virulence PiCp 1 Protein 2e-58 46
fagC YP_005684488.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 2e-58 46
ciuD YP_005681255.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-51 42
ciuD YP_005683346.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-51 42
ciuD YP_003783391.1 iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-51 42
ciuD YP_005685432.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-51 42
DIP0585 NP_938961.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 3e-49 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cg0768 YP_224957.1 ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component BAC0164 Protein 2e-56 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cg0768 YP_224957.1 ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component VFG0925 Protein 2e-68 50
cg0768 YP_224957.1 ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component VFG1042 Protein 2e-56 47