Gene Information

Name : tnp3b(ISCg3b) (cg1757)
Accession : YP_225842.1
Strain : Corynebacterium glutamicum ATCC 13032
Genome accession: NC_006958
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3316
EC number : -
Position : 1647128 - 1647838 bp
Length : 711 bp
Strand : +
Note : -

DNA sequence :
ATGGGCATCTTCTCCGGTCGGCAGTTCCCTCGTGAAATCATCCTGTGGGCGGTGCGGTGGTACTGCCGCTACGGCGTGAG
CTATCGCGACCTCGAAGAGATGATGACCGAGCGGGGAGTGCCGGTCGATCACACCACGATCTACCGCTGGGTCCAGAAAT
ATGCTCCTGAGCTGGATAAGAAGACCCGGTGGTATCGGCAAGTTCCTGACTGGCAGGCCAGGTCCTGGCGGGTGGATGAG
ACCTATATCCGGGTCGGGGGAAAGTGGTGCTACCTCTATCGGGCAATCACCGCCGGTAGCCAGACCCTGGACTTCTACCT
CTCCCCGAAGAGAAACGTCGCGGCGGCGAAGCGTTTCCTGGCGAAGACGCTGCGGTCGAATAAATCGGCAGGCTATCCGC
GGGTGATCAGCACCGACAAGGCCCCCTCACTCGCCAGGGCAATCTCTGAGCTGAAGGCGGAAGGCGTCTGTCCATCGACG
GTCGAGCATCGTCGGGTGAAATACCTCAACAACGTCATTGAAGGCGACCATGGTCGGTTAAAGCGGATCCTGGGGCCGAA
AGGCGCATTCAAAAACCGAACGTCTGCCTACCGGACGTTGAAAGGGATGGAGGCGATGCACTCATTGCGGAAGGGGCAGG
GCACGATGTTTGCCTATGGTCACCCGAATCCGGATGCAGTGATTGTTAGCCGGGTATTCGAGACGGCCTGA

Protein sequence :
MGIFSGRQFPREIILWAVRWYCRYGVSYRDLEEMMTERGVPVDHTTIYRWVQKYAPELDKKTRWYRQVPDWQARSWRVDE
TYIRVGGKWCYLYRAITAGSQTLDFYLSPKRNVAAAKRFLAKTLRSNKSAGYPRVISTDKAPSLARAISELKAEGVCPST
VEHRRVKYLNNVIEGDHGRLKRILGPKGAFKNRTSAYRTLKGMEAMHSLRKGQGTMFAYGHPNPDAVIVSRVFETA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Pmu_03450 YP_005176243.1 IS26 transposase Not tested ICEPmu1 Protein 2e-68 59
tnpA26 AFV53110.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-68 59
tnpA26 AGK07034.1 IS26 transposase Not tested SGI1 Protein 2e-68 59
tnpA26 ACN81018.1 transposase of IS26 Not tested AbaR5 Protein 2e-68 59
tnpA26 AFV53122.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-68 59
tnpA26 AGK07037.1 IS26 transposase Not tested SGI1 Protein 2e-68 59
tnpA26 ACK44541.1 TnpA Not tested SGI1 Protein 2e-68 59
tnpA26 ACN81013.1 transposase of IS26 Not tested AbaR5 Protein 2e-68 59
tnpA26 AGK07039.1 IS26 transposase Not tested SGI1 Protein 2e-68 59
tnpA26 ACK44543.1 TnpA Not tested SGI1 Protein 2e-68 59
tnpA26 AGK07092.1 IS26 transposase Not tested SGI1 Protein 2e-68 59
tpnIS26 ADZ05788.1 transposase Not tested AbaR15 Protein 2e-68 59
tnpA26 AGK07095.1 IS26 transposase Not tested SGI1 Protein 2e-68 59
tpnIS26 ADZ05800.1 transposase Not tested AbaR19 Protein 2e-68 59
tnpA26 AGK07097.1 IS26 transposase Not tested SGI1 Protein 2e-68 59
tnpA AET25383.1 TnpA Not tested PAGI-2(C) Protein 2e-68 59
tnpA26 AFV53107.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-68 59
tnpA26 AFV53108.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-68 59
tnpA AFG30106.1 TnpA Not tested PAGI-2 Protein 2e-68 59
tnp7109-28 YP_001800928.1 transposase for insertion sequence Not tested Not named Protein 2e-68 59
unnamed AEZ06025.1 TnpA26, Transposase of IS26 Not tested AbaR24 Protein 1e-68 59
tnp7109-29 YP_001800930.1 transposase for insertion sequence Not tested Not named Protein 2e-68 59
IS26 CAJ77074.1 Insertion sequence Not tested AbaR1 Protein 1e-68 59
tnp26 AGK36639.1 transposase of IS26 Not tested AbaR26 Protein 2e-68 58
tpnIS26 ADZ05778.1 transposase Not tested AbaR12 Protein 1e-65 58
tnp26 AGK36641.1 transposase of IS26 Not tested AbaR26 Protein 3e-68 58
tnpA26 ACV89829.1 transposase of IS26 Not tested AbaR6 Protein 3e-68 58
tnpA26 ACV89831.1 transposase of IS26 Not tested AbaR7 Protein 3e-68 58
tnpA26 ADK35781.1 transposase of IS26 Not tested AbaR8 Protein 3e-68 58
tpnIS26 ADZ05796.1 transposase Not tested AbaR17 Protein 3e-68 58
tpnIS26 ADZ05798.1 transposase Not tested AbaR18 Protein 3e-68 58
tpnIS26 ADZ05810.1 transposase Not tested AbaR20 Protein 3e-68 58
Pmu_03480 YP_005176246.1 IS26 transposase Not tested ICEPmu1 Protein 5e-68 58
tnpA26 AFV53109.1 transposase of IS26 Not tested AbGRI2-1 Protein 3e-68 58
tpnIS26 ADZ05784.1 transposase Not tested AbaR14 Protein 6e-68 58
tnpA26 ACN81016.1 transposase of IS26 Not tested AbaR5 Protein 5e-68 58
tpnIS26 ADZ05794.1 transposase Not tested AbaR16 Protein 1e-65 58
IS26 CAJ77078.1 Insertion sequence Not tested AbaR1 Protein 3e-68 58
ABTW07_3872 YP_005797120.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 5e-68 58
ABTW07_3875 YP_005797123.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 5e-68 58
ABTW07_3890 YP_005797138.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 5e-68 58
ABTW07_3906 YP_005797154.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 5e-68 58
IS26 CAJ77080.1 Insertion sequence Not tested AbaR1 Protein 6e-50 56
tnpA6100 ACN81001.1 transposase Not tested AbaR5 Protein 3e-57 54
tnpA6100 ACN62081.1 TnpA6100 Not tested SGI1 Protein 2e-57 54
tnpA6100 AGK07113.1 IS6100 transposase Not tested SGI1 Protein 2e-57 54
tnpA AAG03007.1 transposase Not tested SGI1 Protein 2e-57 54
tnp6100 ACS32049.1 Tnp6100 Not tested SGI2 Protein 2e-57 54
CDBH8_0916 YP_005160008.1 transposase-like protein Not tested Not named Protein 3e-57 54
tnp6100 ACX47960.1 tnp6100 Not tested SGI1 Protein 2e-58 54
tnpA6100 AGF34993.1 IS6100 transposase Not tested SGI1 Protein 2e-57 54
tnpA6100 AGK07018.1 IS6100 transposase Not tested SGI1 Protein 2e-58 54
tnpA6100 AGF35032.1 IS6100 transposase Not tested SGI1 Protein 2e-57 54
tnpA6100 AGK07076.1 IS6100 transposase Not tested SGI1 Protein 2e-58 54
tnpA6100 AGF35067.1 IS6100 transposase Not tested SGI1 Protein 2e-57 54
tnpA6100 AGK06937.1 IS6100 transposase Not tested SGI1 Protein 2e-57 54
tnpA6100 AGK06983.1 IS6100 transposase Not tested SGI1 Protein 2e-57 54
tnpA6100 AGK07042.1 IS6100 transposase Not tested SGI1 Protein 2e-57 54
tnpA CAJ77056.1 Transposase Not tested AbaR1 Protein 2e-57 54
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 2e-30 42