Gene Information

Name : BruAb2_0667 (BruAb2_0667)
Accession : YP_223438.1
Strain :
Genome accession: NC_006933
Putative virulence/resistance : Unknown
Product : IS66 family element, orf2
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 679282 - 679668 bp
Length : 387 bp
Strand : +
Note : similar to BRA0557, IS66 family element, orf2, hypothetical

DNA sequence :
GTGCATGGTGTTCAAAGCGCTCAGGGCCTCGGCGTGATCTCACTTGGATCGGATTTGCGGATCATGATTGCTTCAAAGCC
GGTGGACTTCAGGAAGGGCATCAATGGGCTGGCGGCGCTGGTATCGACTGCGCTCGGCGCCAACCCATACTCAGGCGACA
TATATGTCTTCCGCAGCAAGCGTAACGATCGTCTGAAGATGGTCGTTTGGGATGGCAGCGGCATGGTTCTGTTGACCAAA
GTTTTGGAGGATCGGCGTTTTATCTGGCCGGCTGTTCACGCTGGAGCCGTTCGTCTCAGCGCCAGCGAATTGGCGCTTTT
GCTCGATGGCCTGGACTGGACAAGAGTGGAGAAGAAGCCAGTCAAACGGCCCGCAAAAACAGCGTGA

Protein sequence :
MHGVQSAQGLGVISLGSDLRIMIASKPVDFRKGINGLAALVSTALGANPYSGDIYVFRSKRNDRLKMVVWDGSGMVLLTK
VLEDRRFIWPAVHAGAVRLSASELALLLDGLDWTRVEKKPVKRPAKTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-20 48
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-18 47
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-18 47
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-18 46
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-18 46
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-18 45
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 3e-11 43
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-16 42
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-16 42
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-16 42
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-16 42
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-16 42
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-16 42
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-16 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-16 42
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-16 42
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-16 41
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-16 41
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 9e-16 41
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 9e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BruAb2_0667 YP_223438.1 IS66 family element, orf2 VFG1737 Protein 5e-19 45
BruAb2_0667 YP_223438.1 IS66 family element, orf2 VFG1517 Protein 1e-11 43
BruAb2_0667 YP_223438.1 IS66 family element, orf2 VFG0792 Protein 6e-17 42
BruAb2_0667 YP_223438.1 IS66 family element, orf2 VFG1052 Protein 1e-16 42
BruAb2_0667 YP_223438.1 IS66 family element, orf2 VFG1709 Protein 6e-17 42
BruAb2_0667 YP_223438.1 IS66 family element, orf2 VFG1698 Protein 5e-17 41