Gene Information

Name : spaQ (SC2821)
Accession : YP_217808.1
Strain : Salmonella enterica SC-B67
Genome accession: NC_006905
Putative virulence/resistance : Virulence
Product : surface presentation of antigens; secretory proteins
Function : -
COG functional category : U : Intracellular trafficking, secretion and vesicular transport
COG ID : COG4794
EC number : -
Position : 2986913 - 2987173 bp
Length : 261 bp
Strand : -
Note : IPR000595: Cyclic nucleotide-binding domain; IPR002191: Bacterial export protein FliQ, family 3; IPR006306: Type III secretion protein HrpO

DNA sequence :
ATGGATGATTTAGTGTTTGCAGGTAATAAGGCGCTCTATCTTGTTTTGATCCTGTCAGGGTGGCCGACGATTGTCGCAAC
GATTATCGGCCTCCTGGTAGGGTTATTCCAGACGGTAACGCAATTACAGGAACAGACGCTGCCTTTTGGCATTAAATTAC
TTGGCGTGTGTTTATGCTTGTTTTTACTGTCTGGCTGGTATGGCGAAGTTTTACTCTCTTACGGGCGTCAGGTGATATTC
CTGGCGTTGGCTAAGGGGTAA

Protein sequence :
MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCLFLLSGWYGEVLLSYGRQVIF
LALAKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 3e-27 100
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 3e-27 100
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 3e-27 100
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 3e-27 100
spaQ AAS66866.1 SpaQ Not tested SSR-2 Protein 7e-20 71
ECs3724 NP_311751.1 EpaQ Not tested LIM Protein 2e-18 69
epaQ AAZ31292.1 EpaQ Virulence ETT2 Protein 2e-18 68
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 5e-11 54
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 2e-08 50
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 8e-07 47
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 8e-07 47
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 8e-07 47
lscS AAO18039.1 LscS Virulence TTSS locus Protein 1e-05 45
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 2e-06 45
hrcS AAT96201.1 HrcS Virulence T-PAI Protein 6e-07 41
hrcS ABQ88360.1 HrcS Virulence Hrp PAI Protein 1e-04 41
hrpO AAB05076.1 HrpO Virulence Hrp PAI Protein 1e-04 41
hrcS AAT96147.1 HrcS Virulence T-PAI Protein 6e-07 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaQ YP_217808.1 surface presentation of antigens; secretory proteins VFG0550 Protein 8e-28 100
spaQ YP_217808.1 surface presentation of antigens; secretory proteins VFG1013 Protein 4e-19 70
spaQ YP_217808.1 surface presentation of antigens; secretory proteins VFG2454 Protein 3e-12 55
spaQ YP_217808.1 surface presentation of antigens; secretory proteins VFG1772 Protein 2e-15 53
spaQ YP_217808.1 surface presentation of antigens; secretory proteins VFG0187 Protein 8e-04 50
spaQ YP_217808.1 surface presentation of antigens; secretory proteins VFG0395 Protein 6e-07 46
spaQ YP_217808.1 surface presentation of antigens; secretory proteins VFG0043 Protein 9e-05 43