Gene Information

Name : insN (SC2697)
Accession : YP_217684.1
Strain : Salmonella enterica SC-B67
Genome accession: NC_006905
Putative virulence/resistance : Unknown
Product : transposase insN
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2861671 - 2862009 bp
Length : 339 bp
Strand : +
Note : IPR002197: Helix-turn-helix, Fis-type; IPR002514: Transposase, IS3/IS911family

DNA sequence :
GTGATATGCTCACCTCAGAACATTACAGGTGCCTCAATGAAAAAAAGAAATTTCAGTGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTCCTTGATCAGAACTACACCGTTGCAGCTGCGGCCAGTGCTATGGATGTGGGCCTTTCTACCATGACGCGAT
GGGTAAAGCAGTTGCGGGATGAACGACAGGGCAAAATACCTAAAGCCTCCCCTATAACCCCGGAACAAATTGAAATACGT
GAGCTGAAGAAAAAGCTACAACGCATTGAAATGGAAAACGACATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTC
CCTGAACAGTTCTCGTTAA

Protein sequence :
MICSPQNITGASMKKRNFSAEFKRESAQLVLDQNYTVAAAASAMDVGLSTMTRWVKQLRDERQGKIPKASPITPEQIEIR
ELKKKLQRIEMENDILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-34 94
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-39 93
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-39 93
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-39 91
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 73
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-35 73
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-35 73
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 73
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-35 73
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 73
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 73
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-35 73
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 8e-29 70
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-22 59
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-25 58
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-25 58
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-24 57
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-24 57
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-24 57
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-22 56
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 8e-21 47
tnpA CAB61575.1 transposase A Not tested HPI Protein 3e-20 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
insN YP_217684.1 transposase insN VFG1485 Protein 5e-40 93
insN YP_217684.1 transposase insN VFG1123 Protein 2e-35 73
insN YP_217684.1 transposase insN VFG1553 Protein 3e-29 70
insN YP_217684.1 transposase insN VFG0784 Protein 6e-25 57