Gene Information

Name : cusR (VF_A0179)
Accession : YP_206137.1
Strain :
Genome accession: NC_006841
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with CusS
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 201590 - 202270 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence : 
ATGAAACTACTTATTATCGAAGATGAAACAAAAACAGGAGAGTACCTAAAAAAGGGATTAACAGAGTCAGGTTATACTGT
TGATCTATCACAAGATGGTGCTGATGGTTTATATAACGCAACCACCAATCAATACGACTTAATCATCTTAGATGTCATGT
TACCTAAGCTAAATGGTTGGCAAATTCTACAAACACTACGGAATTGTGAAAATGATACGCCAATCATTATGCTCACCGCC
AAAGATCAAATTGATGATAGAGTGAAAGGGTTTGAATTAGGTGCAAATGATTACCTAATTAAACCCTTTGCTTTTGCTGA
ACTAAAAGCTCGTGTTGAAAATGCCCTCAGAGCAAAATCAGTGATTTCGCAACCATCATCAAATGAGTTAGTTTTGCATG
ATTTAAAATTGGATCTGTTAAAACGAACCGCCACAAGAAACCAAGATAATATTACCCTTACTGCAAAAGAGTTTTCATTA
CTTGAGTTATTTATGCGTAAACAAGGGGAAGTATTATCAAGAACAACAATCGCCTCCCTGATTTGGGACATGAACTTTGA
TAGTGATACCAATGTCATTGATGTCGCGGTAAAACGACTTCGTTCTAAAATAGATAAACCCTACGACACCCCACTAATTC
ATACTGTTCGCGGTATGGGTTATAAAATGGACGAGTGCTAG

Protein sequence : 
MKLLIIEDETKTGEYLKKGLTESGYTVDLSQDGADGLYNATTNQYDLIILDVMLPKLNGWQILQTLRNCENDTPIIMLTA
KDQIDDRVKGFELGANDYLIKPFAFAELKARVENALRAKSVISQPSSNELVLHDLKLDLLKRTATRNQDNITLTAKEFSL
LELFMRKQGEVLSRTTIASLIWDMNFDSDTNVIDVAVKRLRSKIDKPYDTPLIHTVRGMGYKMDEC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-52 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-51 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0111 Protein 3e-61 60
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0197 Protein 1e-58 58
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0125 Protein 2e-58 56
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0083 Protein 2e-56 56
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0308 Protein 2e-57 56
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0638 Protein 5e-51 56
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0347 Protein 2e-54 54
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS NC_010079.5776364.p0 Protein 1e-30 41
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS NC_002952.2859858.p0 Protein 1e-30 41
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS NC_007622.3794948.p0 Protein 1e-30 41
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS NC_003923.1003417.p0 Protein 1e-30 41
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS NC_013450.8614146.p0 Protein 1e-30 41
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS NC_002951.3238224.p0 Protein 1e-30 41
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS NC_007793.3914065.p0 Protein 1e-30 41
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS NC_002758.1121390.p0 Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS VFG0596 Protein 3e-52 52
cusR YP_206137.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1389 Protein 6e-34 42