|
Name : rpmJ (ERGA_CDS_04030) Accession : YP_196329.1 Strain : Ehrlichia ruminantium Gardel Genome accession: NC_006831 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0257 EC number : - Position : 664709 - 664837 bp Length : 129 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAAGTTATTGGGTCGTTGAAATCTGCAAAAATAAGAGATAAAGATTGTAGAGTTGTACGTAGGAAAGGGCGTATTTA TGTTATCAATAAAAAAAATCCTAGATTTAAAGCTAGGCAAGGATACTAA Protein sequence : MKVIGSLKSAKIRDKDCRVVRRKGRIYVINKKNPRFKARQGY |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 3e-05 | 64 |
