Gene Information

Name : terE (p1B317)
Accession : YP_195510.1
Strain :
Genome accession: NC_006823
Putative virulence/resistance : Resistance
Product : protein involved in tellurite resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 173426 - 174004 bp
Length : 579 bp
Strand : -
Note : -

DNA sequence :
ATGGCAATCAGTTTGCAAAAGGGCGGGAACATCAGCCTTTCGAAAACAACCCCGAATCTGAAGAACGTAACGATCGGACT
CGGCTGGGATGCTCGTTCGACCTCGGGCGACGACTTCGACCTCGATGCGAGCATTTTCATGGTTGGCGCCAATGGCAAAG
TGCGCTCAGATAGTGATTTCATTTTTTACGGTCAGCTTCGGAGCGCATGCGGTTCGGTCGAGCACACGGGCGACAACCGG
ACCGGCGACGCCGATGGGGATGACGAGGCGATCAACGTCGTACTCGACAAGGTGCCGAGCGACATTACGAGACTGGTCGT
GGCGGTCACCATCCATGAAGCTGATGTTCGTCGCCAGAACTTCGGCATGGTCCATAACGCCTACATCCGAGTGATCAACA
GTGAGAACGATGTCGAGCTGGCTCGTTTTGATCTCACTGAGGACGCCTCGGTAGAGACAGCCATGATTTTCGGCGAAGTC
TATCGCCACAACGGCGAATGGAAGCTACGTGCAGTCGGCCAGGGTTACGCCGGCGGCCTGCATGCACTGGCGATTTCGCA
CGGCGTTAACGTTCAGTAA

Protein sequence :
MAISLQKGGNISLSKTTPNLKNVTIGLGWDARSTSGDDFDLDASIFMVGANGKVRSDSDFIFYGQLRSACGSVEHTGDNR
TGDADGDDEAINVVLDKVPSDITRLVVAVTIHEADVRRQNFGMVHNAYIRVINSENDVELARFDLTEDASVETAMIFGEV
YRHNGEWKLRAVGQGYAGGLHALAISHGVNVQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-60 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-60 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-61 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-61 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-58 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-58 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-58 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-57 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE YP_195510.1 protein involved in tellurite resistance BAC0389 Protein 7e-61 64
terE YP_195510.1 protein involved in tellurite resistance BAC0390 Protein 1e-60 63