Gene Information

Name : terD (p1B315)
Accession : YP_195509.1
Strain :
Genome accession: NC_006823
Putative virulence/resistance : Resistance
Product : protein involved in tellurite resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 172809 - 173384 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGCAATCAGTCTGCAAAAAGGCGGCAATATCAGCCTCTCGAAAGAAGCCCCCGGCATGAAGAAGATGATCGTCGGCCT
GGGTTGGGACGTCCGCTCCACCGATGGCGACGGCTTCGACCTCGATGCGAGCGCGTTCCTGCTCAACAGCACGGGCAAGG
TGCAAAATGATGCCGGCTTCATTTTTTACAACCAGGCCAAGTCCTCTGACGGCAGCATTCAGCATGCCGGCGACAACCGC
ACGGGCGATGGTGAGGGCGATGACGAGTCGATCATCATCGAACTGGACAAGGTGCCGGCCGATATCGAGAAGATTTCGGT
GTGCGTCACGATCCATGATGCGGAAGCGCGGCGCCAGAATTTCGGCATGGTCTCGAGCGCCTACGTGCGCTGCGTGAACG
CCGAGGGGAGCGCGGAGATAGCCCGTTTCGACCTTTCCGAAGACGCCTCGGTTGAAACGGCGATGATTTTCGGTGAAATC
TATCGGCACAACGGCGAATGGAAGTTCAAGGCGATCGGTCAAGGATTCGCTGGTGGTCTCGGCCCGCTTGCGAAGAACTT
CGGTGTCAACGTCTAA

Protein sequence :
MAISLQKGGNISLSKEAPGMKKMIVGLGWDVRSTDGDGFDLDASAFLLNSTGKVQNDAGFIFYNQAKSSDGSIQHAGDNR
TGDGEGDDESIIIELDKVPADIEKISVCVTIHDAEARRQNFGMVSSAYVRCVNAEGSAEIARFDLSEDASVETAMIFGEI
YRHNGEWKFKAIGQGFAGGLGPLAKNFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-65 67
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-58 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-58 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-61 65

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_195509.1 protein involved in tellurite resistance BAC0389 Protein 1e-61 65
terD YP_195509.1 protein involved in tellurite resistance BAC0390 Protein 1e-62 64