Gene Information

Name : ABC4010 (ABC4010)
Accession : YP_177502.1
Strain : Bacillus clausii KSM-K16
Genome accession: NC_006582
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4175940 - 4176620 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
ATGGGAGCTAAAACAGTGCTAGTCGTTGACGATGAGCCTGAGCTGCTTGAGCTTGTAGTTACCTATTTACGAAAAGAGTC
TTACCGGGCGCTGACAGCTGATAATGGCGCCGACGCTCTTAAGCGGATTGAACAGGATGCGGTCGATTTGGTCATTCTTG
ATGTCATGATGGAAGGGATGGATGGCTTTCACGTTTGCGAGCGTATTCGGCAAAAGCATTCACTTCCTGTGATTATGCTG
ACAGCACGAGGCAATGAAGCTGATAAAGTCCGTGGCCTTAAAACCGGTGCCGATGACTACATGGTCAAGCCATTTAGCCC
GAAGGAATTAATGGCCCGTGTCGAGGCAGCGTTGCGCCGTGCAAATATGGACAAAATCCGTGGCAGACGTCTCGTTTTTG
GAGAACTTGAACTTGACCAAGACGGTCGTGCGGTAACCGTTGCTGGAAGCCTTATTAGCCTGACAAGACGGGAATACGAA
TTGTTGCTGTTTTTAGCTGAAAACGCGGGCCGGGCCTTTTCACGGGAGCATTTATTTGAGCGCGTATGGACCGATACGGC
TGCTAGTTCGTTGCGGACGGTCGATACGCATATTAAAACGTTGCGCTTAAAGCTTAATGGGGCCGGACGTTTTATCGAAA
CCGTTTGGGGCGTCGGTTATAAATTTGGAGGAAGCGAATGA

Protein sequence :
MGAKTVLVVDDEPELLELVVTYLRKESYRALTADNGADALKRIEQDAVDLVILDVMMEGMDGFHVCERIRQKHSLPVIML
TARGNEADKVRGLKTGADDYMVKPFSPKELMARVEAALRRANMDKIRGRRLVFGELELDQDGRAVTVAGSLISLTRREYE
LLLFLAENAGRAFSREHLFERVWTDTAASSLRTVDTHIKTLRLKLNGAGRFIETVWGVGYKFGGSE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-25 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABC4010 YP_177502.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-46 45
ABC4010 YP_177502.1 two-component response regulator DQ212986.1.gene4.p01 Protein 1e-39 43
ABC4010 YP_177502.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_002758.1121668.p0 Protein 6e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_009641.5332272.p0 Protein 6e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_013450.8614421.p0 Protein 6e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_007793.3914279.p0 Protein 6e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_002745.1124361.p0 Protein 6e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_009782.5559369.p0 Protein 6e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_002951.3237708.p0 Protein 6e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_003923.1003749.p0 Protein 8e-35 42
ABC4010 YP_177502.1 two-component response regulator NC_002951.3238224.p0 Protein 7e-33 41
ABC4010 YP_177502.1 two-component response regulator NC_007793.3914065.p0 Protein 7e-33 41
ABC4010 YP_177502.1 two-component response regulator NC_002758.1121390.p0 Protein 7e-33 41
ABC4010 YP_177502.1 two-component response regulator NC_010079.5776364.p0 Protein 7e-33 41
ABC4010 YP_177502.1 two-component response regulator NC_002952.2859858.p0 Protein 7e-33 41
ABC4010 YP_177502.1 two-component response regulator NC_007622.3794948.p0 Protein 7e-33 41
ABC4010 YP_177502.1 two-component response regulator NC_003923.1003417.p0 Protein 7e-33 41
ABC4010 YP_177502.1 two-component response regulator NC_013450.8614146.p0 Protein 7e-33 41
ABC4010 YP_177502.1 two-component response regulator FJ349556.1.orf0.gene Protein 4e-41 41
ABC4010 YP_177502.1 two-component response regulator AF130997.1.orf0.gene Protein 1e-33 41
ABC4010 YP_177502.1 two-component response regulator EU250284.1.orf4.gene Protein 7e-34 41
ABC4010 YP_177502.1 two-component response regulator NC_012469.1.7686381. Protein 3e-34 41
ABC4010 YP_177502.1 two-component response regulator BAC0197 Protein 1e-27 41
ABC4010 YP_177502.1 two-component response regulator NC_012469.1.7685629. Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABC4010 YP_177502.1 two-component response regulator VFG1389 Protein 2e-28 41
ABC4010 YP_177502.1 two-component response regulator VFG0596 Protein 7e-26 41
ABC4010 YP_177502.1 two-component response regulator VFG1386 Protein 8e-29 41