Gene Information

Name : ebA7146 (ebA7146)
Accession : YP_161076.1
Strain : Aromatoleum aromaticum EbN1
Genome accession: NC_006513
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4216383 - 4217045 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence : 
ATGCATATCCTGGTCGTCGAAGACGAACCGACACTCGCCGCGCAGCTTGTCGAAGCGCTCGCCGCTGCCGGCTACGCGGT
CGACCGTGCCGACAACGGGCGGGATGCCCACTTCATCGGCGACGTCGAGCCGCTCGACGCGGTGGTGCTCGATCTCGGCC
TGCCGCTGATGGACGGGATCACGGTGCTGAAGAAATGGCGCGCCGCAGGACGCACGATGCCCGTGTTGATCCTTACCGCA
CGCGACAACTGGCATGAAAAAGTCGCCGGGATCGATGCCGGTGCCGACGACTACCTCACCAAGCCGTTCCACATGGAAGA
GCTTCTCGCGCGCCTGCGGGCGCTGATCCGGCGCGCCGGCGGCCACGCCAGCGCCGAGCTCGCGTGCGGTCCGGTGTTGC
TCGACACGCGTGCCGGACGTGTCAGCGTGAATGGCGACGCGGTGAACCTGACCAGCCACGAACTGCGCGTGCTGGATTAC
CTGATGCACCACCAGGGCGAGATCGTGTCGCGCAGCGATCTCACCGAGCACATCTACGCCCAGGATTTCGACCGCGATTC
GAATACCATCGAAGTCTTCATCGGTCGTCTGCGCAAGAAGCTTCCCGCCGGGATGATCGAAACAGTCAGGGGCCTCGGCT
ACCGCATGGTTTGTCCCGCGTGA

Protein sequence : 
MHILVVEDEPTLAAQLVEALAAAGYAVDRADNGRDAHFIGDVEPLDAVVLDLGLPLMDGITVLKKWRAAGRTMPVLILTA
RDNWHEKVAGIDAGADDYLTKPFHMEELLARLRALIRRAGGHASAELACGPVLLDTRAGRVSVNGDAVNLTSHELRVLDY
LMHHQGEIVSRSDLTEHIYAQDFDRDSNTIEVFIGRLRKKLPAGMIETVRGLGYRMVCPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ebA7146 YP_161076.1 two component response regulator NC_002516.2.879194.p Protein 5e-35 45
ebA7146 YP_161076.1 two component response regulator CP004022.1.gene1005. Protein 5e-35 44
ebA7146 YP_161076.1 two component response regulator CP000647.1.gene1136. Protein 2e-32 43
ebA7146 YP_161076.1 two component response regulator BAC0487 Protein 6e-23 43
ebA7146 YP_161076.1 two component response regulator BAC0530 Protein 2e-32 43
ebA7146 YP_161076.1 two component response regulator BAC0638 Protein 1e-16 41
ebA7146 YP_161076.1 two component response regulator CP001918.1.gene2526. Protein 8e-32 41
ebA7146 YP_161076.1 two component response regulator BAC0083 Protein 1e-22 41
ebA7146 YP_161076.1 two component response regulator CP001138.1.gene1939. Protein 4e-33 41
ebA7146 YP_161076.1 two component response regulator BAC0125 Protein 5e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ebA7146 YP_161076.1 two component response regulator VFG1389 Protein 5e-25 44
ebA7146 YP_161076.1 two component response regulator VFG0473 Protein 9e-23 42
ebA7146 YP_161076.1 two component response regulator VFG0475 Protein 4e-33 41