Gene Information

Name : ebA2024 (ebA2024)
Accession : YP_158149.1
Strain : Aromatoleum aromaticum EbN1
Genome accession: NC_006513
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1194617 - 1195297 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
ATGAAAATCCTGATCGTCGAGGACGAGCCGAAAACCGGTGATTACCTGCGCCAGGGGCTGGCCGAGGCGGGCTTCGTCGT
TGATCTCGCGCGCGACGGGCTCGACGGCCTGCATCTCGCGCTCGACGGCGACTACGATCTGATGGTGCTCGACGTGATGC
TGCCGTCGCTCGATGGCTGGGGCGTGTTGCAGACGGTGCGGCGCAGCGGACGCGACATGCCGGTGCTGTTCCTGACCGCG
CGCGATCAGGTCGAGGACCGCGTGCGGGGGCTCGAGCTTGGCGCCGACGACTACCTCGTCAAGCCGTTCGCGTTTTCCGA
GCTGCTCGCGCGCGTGCGCACGCTGCTGCGCCGCGGTAAGGCGAAGGAGCCGGAGGTTTATAGCGCGGGAGACCTCGAAC
TCGACCTGCTGCGTAGACGGGTGACGCGCGCCGGCGTGAAGATCGACCTGACGTCGAAGGAGTTCGCGTTGCTCGAGCTG
TTGTTGCGGCGCCAGGGCGAAGTGCTGCTGCGCTCGCTGATCGCGTCGCAGGTATGGGACATGAACTTCGACAGCGACAC
CAACGTCATCGAAGTCGCGGTGCGGCGGCTGCGCGCGAAAGTCGACGACCCGTTCGAGCCGAAGCTGATCCGCACGGTGC
GCGGCATGGGCTACGTGCTCGAAGCGCCGCAGCCGCGGTGA

Protein sequence :
MKILIVEDEPKTGDYLRQGLAEAGFVVDLARDGLDGLHLALDGDYDLMVLDVMLPSLDGWGVLQTVRRSGRDMPVLFLTA
RDQVEDRVRGLELGADDYLVKPFAFSELLARVRTLLRRGKAKEPEVYSAGDLELDLLRRRVTRAGVKIDLTSKEFALLEL
LLRRQGEVLLRSLIASQVWDMNFDSDTNVIEVAVRRLRAKVDDPFEPKLIRTVRGMGYVLEAPQPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-50 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-50 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ebA2024 YP_158149.1 two component response regulator BAC0638 Protein 6e-61 72
ebA2024 YP_158149.1 two component response regulator BAC0083 Protein 3e-66 69
ebA2024 YP_158149.1 two component response regulator BAC0111 Protein 1e-63 67
ebA2024 YP_158149.1 two component response regulator BAC0197 Protein 1e-63 67
ebA2024 YP_158149.1 two component response regulator BAC0308 Protein 4e-63 65
ebA2024 YP_158149.1 two component response regulator BAC0125 Protein 2e-63 62
ebA2024 YP_158149.1 two component response regulator BAC0347 Protein 1e-56 61
ebA2024 YP_158149.1 two component response regulator HE999704.1.gene1528. Protein 2e-22 44
ebA2024 YP_158149.1 two component response regulator NC_002952.2859905.p0 Protein 7e-31 43
ebA2024 YP_158149.1 two component response regulator NC_013450.8614146.p0 Protein 8e-30 42
ebA2024 YP_158149.1 two component response regulator NC_002951.3238224.p0 Protein 8e-30 42
ebA2024 YP_158149.1 two component response regulator NC_007793.3914065.p0 Protein 8e-30 42
ebA2024 YP_158149.1 two component response regulator NC_002758.1121390.p0 Protein 8e-30 42
ebA2024 YP_158149.1 two component response regulator NC_010079.5776364.p0 Protein 8e-30 42
ebA2024 YP_158149.1 two component response regulator NC_002952.2859858.p0 Protein 8e-30 42
ebA2024 YP_158149.1 two component response regulator NC_007622.3794948.p0 Protein 8e-30 42
ebA2024 YP_158149.1 two component response regulator NC_003923.1003417.p0 Protein 8e-30 42
ebA2024 YP_158149.1 two component response regulator NC_009641.5332272.p0 Protein 7e-31 42
ebA2024 YP_158149.1 two component response regulator NC_013450.8614421.p0 Protein 7e-31 42
ebA2024 YP_158149.1 two component response regulator NC_007793.3914279.p0 Protein 7e-31 42
ebA2024 YP_158149.1 two component response regulator NC_007622.3794472.p0 Protein 7e-31 42
ebA2024 YP_158149.1 two component response regulator NC_002745.1124361.p0 Protein 7e-31 42
ebA2024 YP_158149.1 two component response regulator NC_009782.5559369.p0 Protein 7e-31 42
ebA2024 YP_158149.1 two component response regulator NC_002951.3237708.p0 Protein 7e-31 42
ebA2024 YP_158149.1 two component response regulator NC_002758.1121668.p0 Protein 7e-31 42
ebA2024 YP_158149.1 two component response regulator NC_003923.1003749.p0 Protein 6e-31 42
ebA2024 YP_158149.1 two component response regulator U82965.2.orf14.gene. Protein 3e-24 41
ebA2024 YP_158149.1 two component response regulator AE000516.2.gene3505. Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ebA2024 YP_158149.1 two component response regulator VFG0596 Protein 1e-50 59
ebA2024 YP_158149.1 two component response regulator VFG1390 Protein 9e-39 48
ebA2024 YP_158149.1 two component response regulator VFG1389 Protein 4e-33 45
ebA2024 YP_158149.1 two component response regulator VFG1386 Protein 2e-32 43
ebA2024 YP_158149.1 two component response regulator VFG0473 Protein 6e-29 41