Name : prgI (SPA2731) Accession : YP_151900.1 Strain : Salmonella enterica ATCC 9150 Genome accession: NC_006511 Putative virulence/resistance : Virulence Product : pathogenicity 1 island effector protein Function : - COG functional category : - COG ID : - EC number : - Position : 2830621 - 2830863 bp Length : 243 bp Strand : - Note : similar to Salmonella typhi CT18 pathogenicity 1 island effector protein DNA sequence : ATGCCAACACCTTGGTCAGGCTATCTGGATGAAGTTTCAGCAAAATTTGATACGGGCGTTGATGATCTACAAACGCAGGT AACAGAGGCGCTGGATAAATTAGCAGCAAAACCCTCCGATCCGGCGCTACTGGCGGCGTATCAGAGTAAGCTCTCGGAAT ATAACTTGTACCGTAACGCGCAATCGAACACGGTAAAAGTCTTTAAGGATATTGATGCTGCCATTATTCAGAACTTCCGT TAA Protein sequence : MPTPWSGYLDEVSAKFDTGVDDLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
prgI | YP_217792.1 | cell invasion protein | Virulence | SPI-1 | Protein | 3e-30 | 97 |
prgI | NP_461794.1 | needle complex major subunit | Virulence | SPI-1 | Protein | 3e-30 | 97 |
prgI | AAX49613.1 | PrgI | Virulence | SPI-1 | Protein | 2e-30 | 97 |
prgI | NP_457267.1 | pathogenicity 1 island effector protein | Virulence | SPI-1 | Protein | 5e-30 | 97 |
prgI | NP_806476.1 | pathogenicity island 1 effector protein | Virulence | SPI-1 | Protein | 5e-30 | 97 |
ECs3718 | NP_311745.1 | EprI | Not tested | LIM | Protein | 5e-20 | 63 |
ysaG | AAS66835.1 | YsaG | Not tested | SSR-1 | Protein | 1e-16 | 52 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
prgI | YP_151900.1 | pathogenicity 1 island effector protein | VFG0535 | Protein | 7e-31 | 97 |
prgI | YP_151900.1 | pathogenicity 1 island effector protein | VFG0996 | Protein | 4e-19 | 69 |
prgI | YP_151900.1 | pathogenicity 1 island effector protein | VFG2466 | Protein | 1e-17 | 57 |