Gene Information

Name : SPA2555 (SPA2555)
Accession : YP_151734.1
Strain : Salmonella enterica ATCC 9150
Genome accession: NC_006511
Putative virulence/resistance : Unknown
Product : positive regulator of late gene transcription
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2662672 - 2662890 bp
Length : 219 bp
Strand : -
Note : similar to Salmonella typhi CT18 putative positive regulator of late gene transcription

DNA sequence :
ATGATGAATTGTCCAAAGTGTGGACACTCAGCGCACACTAGGAGCAGCTTTCAGGTTACGGACAGCACAAAAGAGCGTTA
CTGCCAGTGCCAGAACATTAACTGTGGTAGCACCTTTGTCACCCATGAAACGGTAGTGCGCTTTATAGTTACGCCAGCAT
TGGTAAATAACGCTCCTCCACATCCAACAGTGAGTGGGCAAGGGCACATGAATTTTTAA

Protein sequence :
MMNCPKCGHSAHTRSSFQVTDSTKERYCQCQNINCGSTFVTHETVVRFIVTPALVNNAPPHPTVSGQGHMNF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
STY4600 NP_458683.1 putative positive regulator of late gene transcription Not tested SPI-7 Protein 7e-29 100
t4294 NP_807891.1 positive regulator of late gene transcription Not tested SPI-7 Protein 7e-29 100