Gene Information

Name : str1074 (str1074)
Accession : YP_141465.1
Strain : Streptococcus thermophilus CNRZ1066
Genome accession: NC_006449
Putative virulence/resistance : Unknown
Product : truncated IS1216 transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3316
EC number : -
Position : 965561 - 966076 bp
Length : 516 bp
Strand : -
Note : truncated

DNA sequence :
GTGCAAGAGTACAGCAAAGTCCTCTATTATCTTTGGAAGAAGAAAAATAGACAATCCTTATATTCATGGAAAATGGACGA
AACCTATATCAAAATTAAGGGACGTTGGCATTATCTTTATCGTGCAATTGATGCGGACGGCTTAACCTTAGATATCTGGT
TACGAAAGAAACGGGATACGCAAGCAGCCTATGCTTTCTTAAAACGACTCCATAAACAACAGTTTGGTGAGCCGAAAGCA
ATTGTGACCGATAAAGCACCTTCTCTTGGCTCCGCCTTTAGAAAGTTACAGAGTGTGGGTTTATATACTAAGACAGAGCA
CCGAACTGTGAAGTATCTTAACAATTTAATAGAACAGGACCATCAACCTATTAAACGACGGAATAAATTTTATCAAAGTC
TCCGTACAGCCTCTTCCACGATTAAGGGCATGGAGACCATTCGAGGAATATATAAAAAGAACCGAAGAATGGAACGCTCT
TCGGCTTTTCGGTGTCTACTGAAACCAAGGTATTAA

Protein sequence :
MQEYSKVLYYLWKKKNRQSLYSWKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLHKQQFGEPKA
IVTDKAPSLGSAFRKLQSVGLYTKTEHRTVKYLNNLIEQDHQPIKRRNKFYQSLRTASSTIKGMETIRGIYKKNRRMERS
SAFRCLLKPRY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 3e-56 77
unnamed BAD24828.1 transposase for IS431 Not tested Type-V SCCmec Protein 5e-35 58
tnp YP_252034.1 transposase for IS431mec Not tested SCCmec Protein 2e-34 57
tnp BAB72136.1 transposase of IS431mec Not tested Type-IVb SCCmec Protein 7e-34 57
SERP2526 YP_190067.1 IS431mec-like transposase Not tested Type-II SCCmec Protein 1e-33 57
SAR0034 YP_039511.1 transposase Not tested Type-II SCCmec Protein 1e-33 57
tnp BAC67570.1 transposase of IS431mec Not tested Type-IVc SCCmec Protein 7e-34 57
tnp YP_252002.1 transposase for IS431mec Not tested SCCmec Protein 1e-33 57
SAMSHR1132_00280 YP_005324552.1 putative transposase Not tested Type-IIIinv SCCmec Protein 1e-33 57
unnamed BAA82228.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 7e-34 57
unnamed BAB47638.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 9e-34 57
SE0079 NP_763634.1 transposase for IS-like element Not tested SCCpbp4 Protein 9e-34 57
MW0027 NP_644842.1 transposase for IS-like element Not tested Type-IV SCCmec Protein 1e-33 57
SAPIG0054 YP_005732864.1 transposase Not tested Type-V SCCmec Protein 1e-33 57
unnamed BAA82238.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 7e-34 57
unnamed BAB47648.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 9e-34 57
tnp YP_252008.1 transposase for IS431mec Not tested SCCmec Protein 9e-34 57
tnp NP_370551.1 transposase for IS-like element Not tested Type-II SCCmec Protein 1e-33 57
SE0090 NP_763645.1 transposase for IS-like element Not tested SCCpbp4 Protein 1e-33 57
unnamed BAB47635.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 2e-34 57
tnp BAD24823.1 transposase for IS431 Not tested Type-V SCCmec Protein 7e-34 57
tnp NP_370560.2 transposase for IS-like element Not tested Type-II SCCmec Protein 1e-33 57
SERP1579 YP_189144.1 IS431mec-like transposase Not tested ¥ÕSP¥â Protein 1e-33 57
unnamed ACL99852.1 transposase Not tested Type-V SCCmec Protein 1e-34 57
tnp BAA86652.1 transposase Not tested Type-I SCCmec Protein 7e-34 57
SAPIG0038 YP_005732848.1 transposase Not tested Type-V SCCmec Protein 2e-34 57
SA0026 NP_373265.1 transposase for IS-like element Not tested Type-II SCCmec Protein 1e-33 57
SE0071 NP_763626.1 transposase for IS-like element Not tested SCCpbp4 Protein 1e-33 57
tnp BAG06195.1 transposase for IS431 Not tested Type-VII SCCmec Protein 1e-34 57
unnamed BAB47631.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 7e-34 57
SA0034 NP_373274.1 transposase for IS-like element Not tested Type-II SCCmec Protein 1e-33 57
SACOL0028 YP_184939.1 IS431mec, transposase Not tested Type-I SCCmec Protein 1e-33 57
tnp BAB72117.1 transposase of IS431mec Not tested Type-IVa SCCmec Protein 7e-34 57
SAUSA300_0028 YP_492748.1 putative transposase Not tested Type-IV SCCmec Protein 1e-33 57
SAR0027 YP_039504.1 transposase Not tested Type-II SCCmec Protein 1e-33 57
tnp YP_251940.1 transposase for IS431mec Not tested SCCmec Protein 2e-34 56
tnp YP_254240.1 transposase for IS431mec Not tested ¥ðSh1 Protein 4e-32 54
tpnA ADI24151.1 transposase Not tested AbaR1 Protein 3e-18 43
IS26 CAJ77080.1 Insertion sequence Not tested AbaR1 Protein 2e-19 42
tpnIS26 ADZ05778.1 transposase Not tested AbaR12 Protein 1e-19 42