Gene Information

Name : pnf2580 (pnf2580)
Accession : YP_122108.1
Strain :
Genome accession: NC_006363
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 58358 - 58759 bp
Length : 402 bp
Strand : +
Note : -

DNA sequence :
ATGCGGACCGGTGAGCTGGCAGCCAGGGCGGGGATCAACGCGCAGACCCTGCGCTATTACGAGCGCCGTGGTCTGCTCGC
GCGACCGGCGCGGTCCCCGGCAGGCTACCGCAGCTACCCCGACGAGGCGGTCGCGGTGGTCAGGTTCGTCAAACGATCCC
AGGAGCTGGGGTTCACCCTCGACGAGGTCGCCGAACTGCTGCGGCTGGCCGACGGCGGCCCCGACGACTGCGACACCGCC
CGCGCACTGGCCGAGTCGAGGGTTGCCGAGCTGGAACGGCGTATCGCGGACCTGCAGCGCATGCGCGGCTCGCTGGCAGA
GTTGATCGCGACGTGCGAGCTGCCCCGCAACCGCCGGTCCTGTCCGATCCTGACCTCGCTGCACGAAGGAGACCACCCGT
GA

Protein sequence :
MRTGELAARAGINAQTLRYYERRGLLARPARSPAGYRSYPDEAVAVVRFVKRSQELGFTLDEVAELLRLADGGPDDCDTA
RALAESRVAELERRIADLQRMRGSLAELIATCELPRNRRSCPILTSLHEGDHP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 7e-26 45
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-26 44
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-26 44
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-24 43
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-24 43
merR ACK44535.1 MerR Not tested SGI1 Protein 6e-25 43
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 6e-25 43
merR AFG30124.1 MerR Not tested PAGI-2 Protein 6e-25 43
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 8e-25 43
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-22 42
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pnf2580 YP_122108.1 putative transcriptional regulator BAC0688 Protein 5e-27 44
pnf2580 YP_122108.1 putative transcriptional regulator BAC0232 Protein 2e-26 44
pnf2580 YP_122108.1 putative transcriptional regulator BAC0687 Protein 2e-26 44
pnf2580 YP_122108.1 putative transcriptional regulator BAC0684 Protein 4e-26 43
pnf2580 YP_122108.1 putative transcriptional regulator BAC0686 Protein 3e-26 42
pnf2580 YP_122108.1 putative transcriptional regulator BAC0683 Protein 3e-26 42
pnf2580 YP_122108.1 putative transcriptional regulator BAC0689 Protein 3e-25 42
pnf2580 YP_122108.1 putative transcriptional regulator BAC0301 Protein 3e-20 42