Gene Information

Name : nfa55680 (nfa55680)
Accession : YP_121784.1
Strain : Nocardia farcinica IFM 10152
Genome accession: NC_006361
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 5902940 - 5903515 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGTGTCAGTTTGTCCAAGGGCGGCAACGTTTCGCTGACCAAGGCGGCGCCTAACCTGACTGCTGTTTCCGTCGGCCT
GGGGTGGGATGTTCGAACCACCACCGGAACCGACTTCGACCTGGATGCCAGCGCGATCGCGACCGGTGCGGACAAGAAGG
TGCTGTCCGACCAGCACTTCGTGTTCTTCAACAACCTGCGCTCGCCCGAGGGCGCCATCGAGCACGCGGGTGACAACCGC
ACCGGTGAGGGCGAAGGCGACGACGAGGTCATCAACGTCGACCTGGCCAACACCCCGCCGACCATCGAGTCCATCTTCTT
CCCGGTCTCGATCTACGACGCCGACACCCGCCAGCAGTCGTTCGGCCAGGTCCGCAACGCCTACATCCGCGTCGTCGACC
GCAGCAACGGCGAGGAGCTCGCGCGCTACGACCTCACCGAGGACGCCTCCACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCATCGGCCAGGGCTACGCGTCCGGCCTGGCGGGCATCGCCCGTGACTA
CGGCGTGAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKAAPNLTAVSVGLGWDVRTTTGTDFDLDASAIATGADKKVLSDQHFVFFNNLRSPEGAIEHAGDNR
TGEGEGDDEVINVDLANTPPTIESIFFPVSIYDADTRQQSFGQVRNAYIRVVDRSNGEELARYDLTEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-58 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-57 62
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-57 62
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-56 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-55 60
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-57 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-31 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-26 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
nfa55680 YP_121784.1 hypothetical protein BAC0390 Protein 3e-58 60
nfa55680 YP_121784.1 hypothetical protein BAC0389 Protein 2e-56 60
nfa55680 YP_121784.1 hypothetical protein BAC0392 Protein 8e-26 41