Gene Information

Name : irlR2 (BPSS1994)
Accession : YP_112000.1
Strain :
Genome accession: NC_006351
Putative virulence/resistance : Virulence
Product : metal-related two-component system, response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2698676 - 2699368 bp
Length : 693 bp
Strand : +
Note : Similar to Burkholderia pseudomallei transcriptional activator protein IrlR SWALL:IRLR_BURPS (SWALL:O31395) (229 aa) fasta scores: E(): 2.6e-70, 73.24% id in 228 aa, and to Escherichia coli, Escherichia coli O6, and Escherichia coli O157:H7 transcriptiona

DNA sequence : 
ATGAAGGTCCTTATCGTAGAAGACGAGCCGAAGACGGGCATGTATTTGAAGCGCGGGCTCACCGAAGCGGGCTTCGTCTG
CGACTGGACACAGGACGGCATCAGCGGTCTGCATCAGTTGCAGACGGAGAACTACGATCTCGCGATCCTCGACGTGATGC
TGCCCGGTTGCGACGGCTGGACAGTCGTGCGCGAGCTGCGCAGAACGCACCGCACGCCGGTGCTGTTCCTCACCGCGCGC
GATCACGTCGACGATCGCGTGAAAGGCCTCGAGCTCGGCGGCGACGACTATCTCGCGAAGCCGTTCGATTTCGCCGAATT
GCTCGCGCGTGTGCGCTCGCTGCTGCGGCGCGGCCAGGCAACCGATGCGCCGGTGCTGCGCGTCGCCAATCTCGAGCTCG
ATCTCATCCAGCGCAAGGCGCGCCGCCAGGGCAACACGATCCTGCTCACCGCGAAGGAATTCCTGCTGCTGTGGCTGCTG
ATGCGCCGGCAAGGCGAGATCCTGCCGCGCTCGCTGATCGCATCGCAGATCTGGGACATCAACTTCGACAGCGATTCGAA
CGTCGTCGACGCGGCGATCAAGCGCGTGCGCGCGAAGGTCGATCAGGACTACGAGCCCAAGCTGATCCACACGGTGCGTG
GAATGGGATACGTTCTCGAGCAGCGGGGCGAGCCGTGCGAATCGTGTGCATGA

Protein sequence : 
MKVLIVEDEPKTGMYLKRGLTEAGFVCDWTQDGISGLHQLQTENYDLAILDVMLPGCDGWTVVRELRRTHRTPVLFLTAR
DHVDDRVKGLELGGDDYLAKPFDFAELLARVRSLLRRGQATDAPVLRVANLELDLIQRKARRQGNTILLTAKEFLLLWLL
MRRQGEILPRSLIASQIWDINFDSDSNVVDAAIKRVRAKVDQDYEPKLIHTVRGMGYVLEQRGEPCESCA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-57 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-56 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR2 YP_112000.1 metal-related two-component system, response regulator BAC0197 Protein 3e-86 74
irlR2 YP_112000.1 metal-related two-component system, response regulator BAC0083 Protein 5e-66 62
irlR2 YP_112000.1 metal-related two-component system, response regulator BAC0111 Protein 1e-65 61
irlR2 YP_112000.1 metal-related two-component system, response regulator BAC0638 Protein 2e-59 59
irlR2 YP_112000.1 metal-related two-component system, response regulator BAC0125 Protein 1e-64 59
irlR2 YP_112000.1 metal-related two-component system, response regulator BAC0308 Protein 2e-62 58
irlR2 YP_112000.1 metal-related two-component system, response regulator BAC0347 Protein 2e-60 58

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR2 YP_112000.1 metal-related two-component system, response regulator VFG0596 Protein 1e-57 58
irlR2 YP_112000.1 metal-related two-component system, response regulator VFG1390 Protein 2e-38 42
irlR2 YP_112000.1 metal-related two-component system, response regulator VFG1389 Protein 7e-32 42