Gene Information

Name : bsaX (BPSS1536)
Accession : YP_111542.1
Strain :
Genome accession: NC_006351
Putative virulence/resistance : Virulence
Product : surface presentation of antigens protein
Function : -
COG functional category : U : Intracellular trafficking, secretion and vesicular transport
COG ID : COG4794
EC number : -
Position : 2090110 - 2090364 bp
Length : 255 bp
Strand : -
Note : Similar to Salmonella typhimurium, Salmonella typhi, Salmonella dublin, Salmonella enteritidis, Salmonella gallinarum, Salmonella senftenberg, and Salmonella typhisuis surface presentation of antigens protein SpaQ or stm2889 or sty3012 SWALL:SPAQ_SALTY (S

DNA sequence :
ATGGCTGAACTCACCTACGCGGGCGACAAGGCAATCCTGCTCGTGATCCTGCTGTGCGCGGCGCCCGTCGCGGTCGCGAC
CGTCGTGGGCCTCGCGATCGGCCTGTTCCAGACGGTCACGCAATTGCAGGAGCAGACGCTGCCGTTCGGCCTGAAGATGC
TCGCGGTGTTCGGTTGCCTGATGATGCTCTCCGGCTGGTTCGGCGGCAAGCTGCTCGCGTTCGCGACCGAGATGCTGTCG
ATCGGGCTGCGCTGA

Protein sequence :
MAELTYAGDKAILLVILLCAAPVAVATVVGLAIGLFQTVTQLQEQTLPFGLKMLAVFGCLMMLSGWFGGKLLAFATEMLS
IGLR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 6e-22 65
spaQ AAS66866.1 SpaQ Not tested SSR-2 Protein 7e-19 57
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 1e-17 55
ECs3724 NP_311751.1 EpaQ Not tested LIM Protein 6e-19 55
epaQ AAZ31292.1 EpaQ Virulence ETT2 Protein 4e-19 55
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 1e-17 55
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 1e-17 55
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 1e-17 55
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 5e-10 47
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 1e-08 45
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 1e-08 45
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 1e-08 45
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 1e-08 44
escS AFO66341.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 6e-09 43
escS AFO66401.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 6e-09 43
hrcS ABQ88360.1 HrcS Virulence Hrp PAI Protein 3e-05 43
hrpO AAB05076.1 HrpO Virulence Hrp PAI Protein 3e-05 43
hrcS AAT96147.1 HrcS Virulence T-PAI Protein 8e-08 43
hrcS AAT96201.1 HrcS Virulence T-PAI Protein 8e-08 43
hrcS NP_791221.1 type III secretion protein HrcS Virulence Hrp PAI Protein 4e-08 42
hrcS AAG33885.1 HrcS Virulence Hrp PAI Protein 3e-08 42
escS AAL57528.1 EscS Virulence LEE Protein 1e-08 41
escS CAC81848.1 EscS protein Virulence LEE II Protein 1e-08 41
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 2e-08 41
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 2e-08 41
escS AAK26701.1 EscS Virulence LEE Protein 1e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bsaX YP_111542.1 surface presentation of antigens protein VFG2454 Protein 1e-33 100
bsaX YP_111542.1 surface presentation of antigens protein VFG1772 Protein 2e-23 65
bsaX YP_111542.1 surface presentation of antigens protein VFG0550 Protein 3e-18 55
bsaX YP_111542.1 surface presentation of antigens protein VFG1013 Protein 7e-17 54
bsaX YP_111542.1 surface presentation of antigens protein VFG0187 Protein 2e-04 42