Name : bsaX (BPSS1536) Accession : YP_111542.1 Strain : Genome accession: NC_006351 Putative virulence/resistance : Virulence Product : surface presentation of antigens protein Function : - COG functional category : U : Intracellular trafficking, secretion and vesicular transport COG ID : COG4794 EC number : - Position : 2090110 - 2090364 bp Length : 255 bp Strand : - Note : Similar to Salmonella typhimurium, Salmonella typhi, Salmonella dublin, Salmonella enteritidis, Salmonella gallinarum, Salmonella senftenberg, and Salmonella typhisuis surface presentation of antigens protein SpaQ or stm2889 or sty3012 SWALL:SPAQ_SALTY (S DNA sequence : ATGGCTGAACTCACCTACGCGGGCGACAAGGCAATCCTGCTCGTGATCCTGCTGTGCGCGGCGCCCGTCGCGGTCGCGAC CGTCGTGGGCCTCGCGATCGGCCTGTTCCAGACGGTCACGCAATTGCAGGAGCAGACGCTGCCGTTCGGCCTGAAGATGC TCGCGGTGTTCGGTTGCCTGATGATGCTCTCCGGCTGGTTCGGCGGCAAGCTGCTCGCGTTCGCGACCGAGATGCTGTCG ATCGGGCTGCGCTGA Protein sequence : MAELTYAGDKAILLVILLCAAPVAVATVVGLAIGLFQTVTQLQEQTLPFGLKMLAVFGCLMMLSGWFGGKLLAFATEMLS IGLR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ysaS | AAS66847.1 | YsaS | Not tested | SSR-1 | Protein | 6e-22 | 65 |
spaQ | AAS66866.1 | SpaQ | Not tested | SSR-2 | Protein | 7e-19 | 57 |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | Virulence | SPI-1 | Protein | 1e-17 | 55 |
spaQ | NP_457283.1 | secretory protein (associated with virulence) | Virulence | SPI-1 | Protein | 1e-17 | 55 |
spaQ | NP_806492.1 | virulence-associated secretory protein | Virulence | SPI-1 | Protein | 1e-17 | 55 |
spaQ | NP_461810.1 | needle complex export protein | Virulence | SPI-1 | Protein | 1e-17 | 55 |
ECs3724 | NP_311751.1 | EpaQ | Not tested | LIM | Protein | 6e-19 | 55 |
epaQ | AAZ31292.1 | EpaQ | Virulence | ETT2 | Protein | 4e-19 | 55 |
hrcS | AAB06006.1 | HrcS | Virulence | Hrp PAI | Protein | 5e-10 | 47 |
hrcS | AAT96344.1 | HrcS | Virulence | S-PAI | Protein | 1e-08 | 45 |
hrcS | AAT96263.1 | HrcS | Virulence | S-PAI | Protein | 1e-08 | 45 |
hrcS | AAT96304.1 | HrcS | Virulence | S-PAI | Protein | 1e-08 | 45 |
hrcS | ABA47280.1 | HrcS | Virulence | S-PAI | Protein | 1e-08 | 44 |
escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 6e-09 | 43 |
escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 6e-09 | 43 |
hrcS | AAT96201.1 | HrcS | Virulence | T-PAI | Protein | 8e-08 | 43 |
hrcS | ABQ88360.1 | HrcS | Virulence | Hrp PAI | Protein | 3e-05 | 43 |
hrpO | AAB05076.1 | HrpO | Virulence | Hrp PAI | Protein | 3e-05 | 43 |
hrcS | AAT96147.1 | HrcS | Virulence | T-PAI | Protein | 8e-08 | 43 |
hrcS | AAG33885.1 | HrcS | Virulence | Hrp PAI | Protein | 3e-08 | 42 |
hrcS | NP_791221.1 | type III secretion protein HrcS | Virulence | Hrp PAI | Protein | 4e-08 | 42 |
escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 1e-08 | 41 |
escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 1e-08 | 41 |
escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 1e-08 | 41 |
escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-08 | 41 |
escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-08 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
bsaX | YP_111542.1 | surface presentation of antigens protein | VFG2454 | Protein | 1e-33 | 100 |
bsaX | YP_111542.1 | surface presentation of antigens protein | VFG1772 | Protein | 2e-23 | 65 |
bsaX | YP_111542.1 | surface presentation of antigens protein | VFG0550 | Protein | 3e-18 | 55 |
bsaX | YP_111542.1 | surface presentation of antigens protein | VFG1013 | Protein | 7e-17 | 54 |
bsaX | YP_111542.1 | surface presentation of antigens protein | VFG0187 | Protein | 2e-04 | 42 |