Gene Information

Name : BPSL3379 (BPSL3379)
Accession : YP_109973.1
Strain :
Genome accession: NC_006350
Putative virulence/resistance : Resistance
Product : MerR family regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 4011201 - 4011632 bp
Length : 432 bp
Strand : +
Note : Similar to Escherichia coli, and Escherichia coli O157:H7 Zn(ii)-responsive regulator of zntA ZntR SWALL:ZNTR_ECOLI (SWALL:P36676) (141 aa) fasta scores: E(): 3.8e-13, 39.06% id in 128 aa, and to Pseudomonas putida MerR family response regulator of cadmiu

DNA sequence : 
ATGAAGATCGGCGAACTGGCGAAAGCGGCGCGGTGCACGCCGGAAACGATTCGCTTCTATGAAAAAGAGGGGCTGATGCC
CGACGCGGAACGGACCGATTCCAACTACCGCCACTACACCGACGCGCACGTCGAGCGGCTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGACGCACGATGAAATCCGCGCACTGCTGCGCTTCACCGACGACCCGGCGGACCGCTGCGATTCGGTC
AACGCGCTGCTCGACGAACACATCGGCCACGTCAACACGCGGCTTGCCGAACTGCAGCATTTGCGCATGCAATTGATCGA
ATTGCGCGAACGGTGCCAGGGCGAGCACGCAGTCGAGGATTGCGGCATCGTGCATGGCCTCGCGACGATGGAAACGCCGG
ACATGCCCGGCAAACGCTCGCACGTCGGCTGA

Protein sequence : 
MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRHYTDAHVERLRFIRNCRALDMTHDEIRALLRFTDDPADRCDSV
NALLDEHIGHVNTRLAELQHLRMQLIELRERCQGEHAVEDCGIVHGLATMETPDMPGKRSHVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 5e-31 50
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 1e-33 50
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-33 50
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 8e-34 50
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 8e-34 50
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 2e-33 49
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-33 49
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 2e-33 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BPSL3379 YP_109973.1 MerR family regulatory protein BAC0058 Protein 2e-38 59
BPSL3379 YP_109973.1 MerR family regulatory protein BAC0301 Protein 1e-31 54