Gene Information

Name : qacE (BPSL1861)
Accession : YP_108460.1
Strain :
Genome accession: NC_006350
Putative virulence/resistance : Virulence
Product : quaternary ammonium compound-resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2215194 - 2215532 bp
Length : 339 bp
Strand : -
Note : Similar to Escherichia coli, Salmonella typhimurium, and Pseudomonas aeruginosa ethidium bromide resistance protein Ebr or E1 SWALL:EBR_ECOLI (SWALL:P14502) (115 aa) fasta scores: E(): 1.7e-16, 53% id in 100 aa, and to the plasmid borne Escherichia coli,

DNA sequence :
ATGCAACTTCCAGGTTACGCATGGCTCGCGATCGCGATCGTCGCCGAGGTGGTCGGCACGTCGGCGCTGCGCGCAGCCGA
AGGTTTCACGCGGCTCTGGCCGACGCTCGTCGTCGCCCTCGGCTACGGCACCGCGTTCTACTGCCTGTCGCTCACGCTCA
AGAGCATGCCCGTCGGCATCGTGTACGCGATCTGGTCGGGCGCGGGCATCGTGCTCATCACGCTCGTCGCGCTCGTGCTC
TATCGGCAGGTGCCGGACTGGCCCGCGGTCGTCGGGCTCGCGCTCATCGTCGCGGGCGTCGTGGTGCTCAATCTCTTTTC
GAAAATGCAGGCGCATTGA

Protein sequence :
MQLPGYAWLAIAIVAEVVGTSALRAAEGFTRLWPTLVVALGYGTAFYCLSLTLKSMPVGIVYAIWSGAGIVLITLVALVL
YRQVPDWPAVVGLALIVAGVVVLNLFSKMQAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 8e-17 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qacE YP_108460.1 quaternary ammonium compound-resistance protein BAC0377 Protein 8e-22 60
qacE YP_108460.1 quaternary ammonium compound-resistance protein BAC0322 Protein 2e-15 58
qacE YP_108460.1 quaternary ammonium compound-resistance protein NC_010410.6003348.p0 Protein 4e-16 55
qacE YP_108460.1 quaternary ammonium compound-resistance protein BAC0002 Protein 4e-16 55
qacE YP_108460.1 quaternary ammonium compound-resistance protein CP004022.1.gene1549. Protein 2e-15 50
qacE YP_108460.1 quaternary ammonium compound-resistance protein CP001138.1.gene1489. Protein 7e-14 50
qacE YP_108460.1 quaternary ammonium compound-resistance protein AE000516.2.gene3301. Protein 6e-10 50
qacE YP_108460.1 quaternary ammonium compound-resistance protein BAC0249 Protein 6e-10 50
qacE YP_108460.1 quaternary ammonium compound-resistance protein NC_002695.1.913273.p Protein 5e-12 49
qacE YP_108460.1 quaternary ammonium compound-resistance protein BAC0150 Protein 5e-12 47
qacE YP_108460.1 quaternary ammonium compound-resistance protein BAC0327 Protein 2e-16 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qacE YP_108460.1 quaternary ammonium compound-resistance protein VFG1586 Protein 3e-17 41