Gene Information

Name : yceE (BLi00356)
Accession : YP_006711787.1
Strain : Bacillus licheniformis DSM 13
Genome accession: NC_006322
Putative virulence/resistance : Resistance
Product : stress protein YceE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 332365 - 332943 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGCGATTCAATTATCTAAAGGACAAAGGATCGATTTAACGAAAACGAACCCCGGTTTGACGAAAGCGCTGATCGGTTT
AGGCTGGGATACAAACAAATATACCGGCGGCGCCGATTTTGACTTGGACGCGTCGGCTTTTCTTGTCGATCAGAACGATC
GATGCATCAATGATCACGACTTCGTTTTTTACAACAACCTCGAGCATCCAAGCGGCGCCGTGATTCATACGGGCGACAAC
CGGACAGGAGAAGGTGAAGGCGATGACGAGCAAATCATCGTCGATTTCTCAAAAATCCCCGCTCATGTTGAAAAGATCGG
CATCACGGTGACGATTCACGAGGCGGAAAGCCGCAGCCAGAACTTTGGACAAGTCTCAAATGCGTTTGTCCGGCTCGTAG
ATGAATCAACAAATGAAGAGCTGCTTCGCTTTGACTTGGGAGAGGATTTTTCAATTGAGACAGCGGTTGTTGTTTGCGAA
TTGTACCGTCACGGAGGAGATTGGAAATTCAATGCCATCGGCAGCGGGTTTTCCGGCGGATTGGCATCGCTTTGCCGCAA
CTACGGCCTGCAAGTCTAG

Protein sequence :
MAIQLSKGQRIDLTKTNPGLTKALIGLGWDTNKYTGGADFDLDASAFLVDQNDRCINDHDFVFYNNLEHPSGAVIHTGDN
RTGEGEGDDEQIIVDFSKIPAHVEKIGITVTIHEAESRSQNFGQVSNAFVRLVDESTNEELLRFDLGEDFSIETAVVVCE
LYRHGGDWKFNAIGSGFSGGLASLCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-54 56
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 54
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-51 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-47 52
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 52
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-45 49
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-26 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceE YP_006711787.1 stress protein YceE BAC0390 Protein 3e-52 56
yceE YP_006711787.1 stress protein YceE BAC0389 Protein 5e-52 54