Gene Information

Name : MS2298 (MS2298)
Accession : YP_089490.1
Strain : Mannheimia succiniciproducens MBEL55E
Genome accession: NC_006300
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2226853 - 2227167 bp
Length : 315 bp
Strand : +
Note : Transposase

DNA sequence :
ATGAGAAGAACATTTAGCGCAGAATATAAAGCTGAAGCAGTAAAATTAGTGATTGAACGAGGATATTCGGTTTCTCAAGC
TTGCCGAGAGTTAGGTGTGGGTGAAACAGCACTTCGTCGCTGGATAAGTCAAGTTCAAGCGGAGCAACAAGGTTACGTTT
TAGCTGGTTCAAAGCCAATTAGCCCAGAACAACAACGAATTCGAGAACTTGAAAATCGTATTAAAGAACTTGAAGAAGAT
AAGGACATTTTAAAAAAGGCTACAGCGATTTTAATGTCACTCGAAAACAAAAATACCAAGTCATTACGACGTTAA

Protein sequence :
MRRTFSAEYKAEAVKLVIERGYSVSQACRELGVGETALRRWISQVQAEQQGYVLAGSKPISPEQQRIRELENRIKELEED
KDILKKATAILMSLENKNTKSLRR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-18 62
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-13 48
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-13 48
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-12 47
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-12 47
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-12 47
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-12 47
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-12 47
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-12 47
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-12 47
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-12 47
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-11 44
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-12 43
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-12 43
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-11 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MS2298 YP_089490.1 hypothetical protein VFG1123 Protein 7e-13 47
MS2298 YP_089490.1 hypothetical protein VFG1553 Protein 1e-11 44
MS2298 YP_089490.1 hypothetical protein VFG1485 Protein 5e-13 43