Gene Information

Name : MS0979 (MS0979)
Accession : YP_088171.1
Strain : Mannheimia succiniciproducens MBEL55E
Genome accession: NC_006300
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 954476 - 954790 bp
Length : 315 bp
Strand : -
Note : Transposase

DNA sequence :
ATGAGAAGAACATTTAGCGCAGAATATAAAGCTGAAGCAGTAAAATTAGTGATTGAACGAGGATATTCGGTTTCTCAAGC
TTGCCGAGAGTTAGGTGTGGGTGAAACAGCACTTCGTCGCTGGATAAGTCAAGTTCAAGCGGAGCAACAAGGTTACGTTT
TAGCTGGTTCAAAGCCAATTAGCCCAGAACAACAACGAATTCGAGAACTTGAAAATCGTATTAAAGAACTTGAAGAAGAT
AAGGCCATTTTAAAAAAGGCTACAGCGATTTTAATGTCACTCGAAAACAAAAATACCAAGTCATTACGACGTTAA

Protein sequence :
MRRTFSAEYKAEAVKLVIERGYSVSQACRELGVGETALRRWISQVQAEQQGYVLAGSKPISPEQQRIRELENRIKELEED
KAILKKATAILMSLENKNTKSLRR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-23 64
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-19 48
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-19 48
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-17 47
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-17 47
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-17 47
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-17 47
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-17 47
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-17 47
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-17 47
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-17 47
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-18 46
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 1e-15 46
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-18 46
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-18 46
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-18 46
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-16 44
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-16 43
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-16 43
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-15 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MS0979 YP_088171.1 hypothetical protein VFG1123 Protein 1e-17 47
MS0979 YP_088171.1 hypothetical protein VFG0784 Protein 5e-19 46
MS0979 YP_088171.1 hypothetical protein VFG1553 Protein 2e-16 44
MS0979 YP_088171.1 hypothetical protein VFG1485 Protein 4e-17 43