Gene Information

Name : STH750 (STH750)
Accession : YP_074579.1
Strain : Symbiobacterium thermophilum IAM 14863
Genome accession: NC_006177
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 835459 - 836166 bp
Length : 708 bp
Strand : -
Note : -

DNA sequence :
GTGTTCCCTGTGCCCGAGCGGATTCTCGTCGTCGATGATGAGCCCTCGATCCTCGAACTGGTCGCGTACAACTTGCGCCG
GGCGGGCTTCGAAGTGCTGACCGCGGACAACGGCGAGGACGGGCTGCGCATCGCCCGGGAGGAAGAGATCGACCTGGTGA
TCCTGGACGTGATGCTGCCCGGGATCGACGGATTCGAGGTCCTGCGCGCCCTCCGCCGCCACTCCGAACTGCCGGTGCTG
ATGCTCACCGCCCGGGGCGAGGAGATCGACCGGGTGGTGGGGTTCGAGATCGGCGCCGACGACTACGTGACCAAGCCGTT
CAGCCCCCGGGAGCTGACCGGGCGGGTGAAGGCGATCCTCCGCCGGGCGCGCAGAAGTGCGGAACCCCAGGACCAGGACA
CGCTGGTCCTCGGGCCGCTCACCATCAACTTCGCAAGCTACGAGGTCCTGCGCGACGGCCGGCGCGTGGACCTCACCCCC
ACCGAGTTCCAGATCCTGGGCGTCCTTGCCCGGTCCCCGGGCCGGGTGTTCACCCGGGACGAGCTGGTGGACCGGGTGAT
GGGCCCGGACTTCTACGGCGACGTCCGCACCGTGGACGTGCACATCCGGCACCTCCGGGCCAAGCTGGAGGAAAACCCCT
CCGAGCCCAGGCTGATCGAGACGGTGCGGGGCGTCGGCTACCGGTTCGCCGGGCCGAGGCGCAGGTAG

Protein sequence :
MFPVPERILVVDDEPSILELVAYNLRRAGFEVLTADNGEDGLRIAREEEIDLVILDVMLPGIDGFEVLRALRRHSELPVL
MLTARGEEIDRVVGFEIGADDYVTKPFSPRELTGRVKAILRRARRSAEPQDQDTLVLGPLTINFASYEVLRDGRRVDLTP
TEFQILGVLARSPGRVFTRDELVDRVMGPDFYGDVRTVDVHIRHLRAKLEENPSEPRLIETVRGVGYRFAGPRRR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-34 44
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 43
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-33 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH750 YP_074579.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-50 49
STH750 YP_074579.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-50 49
STH750 YP_074579.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-50 49
STH750 YP_074579.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-50 49
STH750 YP_074579.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-50 49
STH750 YP_074579.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-50 49
STH750 YP_074579.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-50 49
STH750 YP_074579.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-50 49
STH750 YP_074579.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-50 49
STH750 YP_074579.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-50 49
STH750 YP_074579.1 two-component response regulator AE016830.1.gene1681. Protein 2e-51 48
STH750 YP_074579.1 two-component response regulator HE999704.1.gene2815. Protein 3e-49 48
STH750 YP_074579.1 two-component response regulator NC_012469.1.7685629. Protein 1e-45 48
STH750 YP_074579.1 two-component response regulator CP001138.1.gene2239. Protein 3e-43 45
STH750 YP_074579.1 two-component response regulator CP000034.1.gene2186. Protein 8e-44 45
STH750 YP_074579.1 two-component response regulator BAC0596 Protein 3e-43 45
STH750 YP_074579.1 two-component response regulator BAC0039 Protein 8e-44 45
STH750 YP_074579.1 two-component response regulator NC_002695.1.916589.p Protein 6e-44 45
STH750 YP_074579.1 two-component response regulator CP000675.2.gene1535. Protein 4e-48 44
STH750 YP_074579.1 two-component response regulator BAC0125 Protein 5e-39 44
STH750 YP_074579.1 two-component response regulator AE000516.2.gene3505. Protein 7e-41 44
STH750 YP_074579.1 two-component response regulator BAC0197 Protein 3e-35 44
STH750 YP_074579.1 two-component response regulator NC_012469.1.7686381. Protein 6e-44 43
STH750 YP_074579.1 two-component response regulator AF162694.1.orf4.gene Protein 5e-39 43
STH750 YP_074579.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-46 43
STH750 YP_074579.1 two-component response regulator CP001485.1.gene721.p Protein 2e-38 43
STH750 YP_074579.1 two-component response regulator CP001918.1.gene5135. Protein 5e-31 43
STH750 YP_074579.1 two-component response regulator CP001918.1.gene3444. Protein 1e-41 43
STH750 YP_074579.1 two-component response regulator CP000647.1.gene2531. Protein 1e-41 43
STH750 YP_074579.1 two-component response regulator AF130997.1.orf0.gene Protein 3e-36 42
STH750 YP_074579.1 two-component response regulator DQ212986.1.gene4.p01 Protein 4e-39 42
STH750 YP_074579.1 two-component response regulator BAC0638 Protein 8e-31 42
STH750 YP_074579.1 two-component response regulator CP001138.1.gene4273. Protein 6e-34 42
STH750 YP_074579.1 two-component response regulator AF310956.2.orf0.gene Protein 1e-33 41
STH750 YP_074579.1 two-component response regulator AE016830.1.gene2255. Protein 4e-33 41
STH750 YP_074579.1 two-component response regulator U35369.1.gene1.p01 Protein 4e-33 41
STH750 YP_074579.1 two-component response regulator NC_010410.6002989.p0 Protein 2e-36 41
STH750 YP_074579.1 two-component response regulator NC_010400.5986590.p0 Protein 6e-37 41
STH750 YP_074579.1 two-component response regulator NC_011595.7057856.p0 Protein 2e-36 41
STH750 YP_074579.1 two-component response regulator BAC0083 Protein 3e-35 41
STH750 YP_074579.1 two-component response regulator EU250284.1.orf4.gene Protein 3e-38 41
STH750 YP_074579.1 two-component response regulator FJ349556.1.orf0.gene Protein 9e-46 41
STH750 YP_074579.1 two-component response regulator CP000647.1.gene4257. Protein 2e-33 41
STH750 YP_074579.1 two-component response regulator CP004022.1.gene3215. Protein 6e-36 41
STH750 YP_074579.1 two-component response regulator NC_002695.1.915041.p Protein 1e-33 41
STH750 YP_074579.1 two-component response regulator BAC0533 Protein 2e-33 41
STH750 YP_074579.1 two-component response regulator CP000034.1.gene3834. Protein 1e-33 41
STH750 YP_074579.1 two-component response regulator NC_008702.1.4607594. Protein 3e-34 41
STH750 YP_074579.1 two-component response regulator CP000034.1.gene3671. Protein 3e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH750 YP_074579.1 two-component response regulator VFG1389 Protein 1e-32 46
STH750 YP_074579.1 two-component response regulator VFG1386 Protein 5e-38 44
STH750 YP_074579.1 two-component response regulator VFG0596 Protein 8e-35 43
STH750 YP_074579.1 two-component response regulator VFG1390 Protein 2e-33 42