Gene Information

Name : STH3290 (STH3290)
Accession : YP_077115.1
Strain : Symbiobacterium thermophilum IAM 14863
Genome accession: NC_006177
Putative virulence/resistance : Resistance
Product : two-component response regulator, CheY-like
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3514664 - 3515362 bp
Length : 699 bp
Strand : -
Note : -

DNA sequence :
ATGGCCCCGGGGAAGCGGCCTGTGGTGCTGGTGGTGGACGACGAGCCCCGCATGCGCGAGCTGATCCGGCTGTACCTCGC
GGCGGAGTGCACCGTGCTCGAGGCCGGGGACGGCCTCACCGCCCTGCGGGCGGTGCGTGACGCGGGGCCTGACCTCGTGC
TGCTGGACGTGATGATGCCCCGGTTGGACGGGTGGCAGACGCTGCAACGCATCCGCGAGGAGTCTGCCGTGCCCGTCATC
ATGCTCACCGCCCGGGGCGGTGTGGCGGATCGGGTACAGGGGCTCCGGATGGGCGCCGACGACTACATCGCCAAGCCCTT
CGACGGCCGGGAGCTGGCCGCCCGGGTCCAGGCCGTGCTCCGCCGCTCGGCCGGACAGGTGGAGGCGAACGTCCCCATCC
GCCGGGGCAGCCTGACGATCCGGCCGGCAGAGCGGACGGCGTTGTACGCCGGCCGTCCCCTGCCCCTCACTCCCAAGGAG
TTTGACCTCCTGGCCCTGCTGGCGGCGCACCCGGGTCAGGTCTTCTCCCGGGAGAAGCTGCTGGACCGCATCTGGGGGCC
CGACTTCCAGGGCGACGCCCGCACGGTGGACGCCCACATCAAGAACCTGCGGGACAAGCTGGGCGAGGGCGCGGGGCTCA
TCCTCACGGTCTGGGGCGTGGGGTACCGGTTCGCGGAGGTGCCGGATGCGCAGCCTTAG

Protein sequence :
MAPGKRPVVLVVDDEPRMRELIRLYLAAECTVLEAGDGLTALRAVRDAGPDLVLLDVMMPRLDGWQTLQRIREESAVPVI
MLTARGGVADRVQGLRMGADDYIAKPFDGRELAARVQAVLRRSAGQVEANVPIRRGSLTIRPAERTALYAGRPLPLTPKE
FDLLALLAAHPGQVFSREKLLDRIWGPDFQGDARTVDAHIKNLRDKLGEGAGLILTVWGVGYRFAEVPDAQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-28 43
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 8e-28 42
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 8e-28 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 8e-28 42
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 8e-28 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH3290 YP_077115.1 two-component response regulator, CheY-like CP001918.1.gene5135. Protein 4e-26 46
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_002952.2859905.p0 Protein 1e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_009782.5559369.p0 Protein 2e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_002951.3237708.p0 Protein 2e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_003923.1003749.p0 Protein 2e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_002758.1121668.p0 Protein 2e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_007622.3794472.p0 Protein 1e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_009641.5332272.p0 Protein 2e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like CP004022.1.gene3215. Protein 7e-32 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_013450.8614421.p0 Protein 2e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_007793.3914279.p0 Protein 2e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_002745.1124361.p0 Protein 2e-37 45
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_010400.5986590.p0 Protein 5e-38 44
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_010410.6002989.p0 Protein 1e-38 44
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_011595.7057856.p0 Protein 1e-38 44
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_012469.1.7685629. Protein 3e-38 44
STH3290 YP_077115.1 two-component response regulator, CheY-like CP001918.1.gene3444. Protein 3e-32 43
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_012469.1.7686381. Protein 5e-35 42
STH3290 YP_077115.1 two-component response regulator, CheY-like DQ212986.1.gene4.p01 Protein 2e-36 42
STH3290 YP_077115.1 two-component response regulator, CheY-like AE000516.2.gene3505. Protein 2e-31 42
STH3290 YP_077115.1 two-component response regulator, CheY-like CP001138.1.gene2239. Protein 4e-33 42
STH3290 YP_077115.1 two-component response regulator, CheY-like NC_002695.1.916589.p Protein 1e-32 42
STH3290 YP_077115.1 two-component response regulator, CheY-like BAC0039 Protein 1e-32 42
STH3290 YP_077115.1 two-component response regulator, CheY-like BAC0596 Protein 4e-33 42
STH3290 YP_077115.1 two-component response regulator, CheY-like CP000647.1.gene2531. Protein 3e-32 42
STH3290 YP_077115.1 two-component response regulator, CheY-like CP000034.1.gene2186. Protein 1e-32 42
STH3290 YP_077115.1 two-component response regulator, CheY-like AF310956.2.orf0.gene Protein 4e-36 41
STH3290 YP_077115.1 two-component response regulator, CheY-like AF155139.2.orf0.gene Protein 5e-43 41
STH3290 YP_077115.1 two-component response regulator, CheY-like CP001485.1.gene721.p Protein 7e-31 41
STH3290 YP_077115.1 two-component response regulator, CheY-like BAC0197 Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH3290 YP_077115.1 two-component response regulator, CheY-like VFG1389 Protein 1e-30 46