Gene Information

Name : STH2506 (STH2506)
Accession : YP_076335.1
Strain : Symbiobacterium thermophilum IAM 14863
Genome accession: NC_006177
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2691403 - 2692104 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGGCGGAGCCGCTGATCCTGGTCGTGGACGACGAGCAGGCGATTGCCGACCTGATCGAGATCCACCTGTTGGCGGAGGG
CTACCGGGTGCGCAAGGCGGACAACGGTGCCGATGCCCTGCGCATCGTGGCCGAGGAGGATCCCGACCTGGTGGTGCTCG
ACATCATGATGCCCGGCATGGACGGCCTGGAGGTCTGCCGGGCGATCCGGCGCGAGCGCAACGTGCCGATCCTCATGCTC
AGCGCCAAGTCGGAGGACGTGGATAAGATCCTTGGCCTGAAGACCGGGGCCGACGACTACCTCACCAAGCCCTTCAACCC
GCTGGAGCTGGTGGCCCGGGTGAAGGCGCAATTGCGGCGCTACCTTTCCCTGAACCCGGCGTCGGCGGCGGCCCGGGAGC
CGGGGGTTCTCGCCGTGGGCGGGCTCCGGATCGACCCGCTAGGCCGGTCGGTGTTCAAGGACGGGCGCGAGATTGCCCTC
ACGCCGACGGAGTTCGACATCCTGCTGCTGCTGGCATCGCACCCGGGGCGGGTCTTCAGCTCGGAGGAGATCTTCGAGCG
GGTCTGGAAGGAGCACTACTTCCAGTCCAACAACACGGTGATGGTCCACATCCGCCGGCTGCGGGAGAAGGTGGAGGACG
ACCCCAGCCATCCCACGCTCATCCGGACCGTCTGGGGGGTCGGCTACAAGATTGAGAAGTAA

Protein sequence :
MAEPLILVVDDEQAIADLIEIHLLAEGYRVRKADNGADALRIVAEEDPDLVVLDIMMPGMDGLEVCRAIRRERNVPILML
SAKSEDVDKILGLKTGADDYLTKPFNPLELVARVKAQLRRYLSLNPASAAAREPGVLAVGGLRIDPLGRSVFKDGREIAL
TPTEFDILLLLASHPGRVFSSEEIFERVWKEHYFQSNNTVMVHIRRLREKVEDDPSHPTLIRTVWGVGYKIEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-41 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH2506 YP_076335.1 two-component response regulator FJ349556.1.orf0.gene Protein 8e-60 54
STH2506 YP_076335.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-61 53
STH2506 YP_076335.1 two-component response regulator AF162694.1.orf4.gene Protein 4e-52 52
STH2506 YP_076335.1 two-component response regulator AM180355.1.gene1830. Protein 3e-54 52
STH2506 YP_076335.1 two-component response regulator AF130997.1.orf0.gene Protein 5e-53 52
STH2506 YP_076335.1 two-component response regulator DQ212986.1.gene4.p01 Protein 3e-55 52
STH2506 YP_076335.1 two-component response regulator EU250284.1.orf4.gene Protein 2e-50 50
STH2506 YP_076335.1 two-component response regulator NC_005054.2598277.p0 Protein 3e-54 50
STH2506 YP_076335.1 two-component response regulator NC_014475.1.orf0.gen Protein 3e-54 50
STH2506 YP_076335.1 two-component response regulator NC_012469.1.7685629. Protein 3e-44 49
STH2506 YP_076335.1 two-component response regulator NC_002952.2859905.p0 Protein 6e-48 45
STH2506 YP_076335.1 two-component response regulator NC_003923.1003749.p0 Protein 7e-48 45
STH2506 YP_076335.1 two-component response regulator NC_002758.1121668.p0 Protein 8e-48 45
STH2506 YP_076335.1 two-component response regulator NC_007622.3794472.p0 Protein 6e-48 45
STH2506 YP_076335.1 two-component response regulator NC_009641.5332272.p0 Protein 8e-48 45
STH2506 YP_076335.1 two-component response regulator NC_013450.8614421.p0 Protein 8e-48 45
STH2506 YP_076335.1 two-component response regulator NC_007793.3914279.p0 Protein 8e-48 45
STH2506 YP_076335.1 two-component response regulator NC_002745.1124361.p0 Protein 8e-48 45
STH2506 YP_076335.1 two-component response regulator NC_009782.5559369.p0 Protein 8e-48 45
STH2506 YP_076335.1 two-component response regulator NC_002951.3237708.p0 Protein 8e-48 45
STH2506 YP_076335.1 two-component response regulator AE000516.2.gene3505. Protein 6e-42 45
STH2506 YP_076335.1 two-component response regulator NC_012469.1.7686381. Protein 7e-43 44
STH2506 YP_076335.1 two-component response regulator HE999704.1.gene2815. Protein 8e-46 44
STH2506 YP_076335.1 two-component response regulator AE016830.1.gene1681. Protein 1e-44 42
STH2506 YP_076335.1 two-component response regulator CP000034.1.gene3671. Protein 8e-42 42
STH2506 YP_076335.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-34 41
STH2506 YP_076335.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-34 41
STH2506 YP_076335.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-34 41
STH2506 YP_076335.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-34 41
STH2506 YP_076335.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-34 41
STH2506 YP_076335.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-34 41
STH2506 YP_076335.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-34 41
STH2506 YP_076335.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-34 41
STH2506 YP_076335.1 two-component response regulator BAC0125 Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH2506 YP_076335.1 two-component response regulator VFG1389 Protein 1e-29 44
STH2506 YP_076335.1 two-component response regulator VFG1390 Protein 2e-36 43
STH2506 YP_076335.1 two-component response regulator VFG0596 Protein 4e-33 41
STH2506 YP_076335.1 two-component response regulator VFG1563 Protein 2e-41 41
STH2506 YP_076335.1 two-component response regulator VFG1702 Protein 2e-41 41