Gene Information

Name : STH2007 (STH2007)
Accession : YP_075836.1
Strain : Symbiobacterium thermophilum IAM 14863
Genome accession: NC_006177
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2147902 - 2148591 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGCCGCACATCCTCGTCGTCGACGACGAACCGGGCCTGGTGAAGGGCCTCCGGCTCAGCCTGGAGCAGGAGGGCTTCCA
GGTGACCACCGCGTCCGACGGGCGGGAGGCGCTCAGCAAGTTTCGCGCGGGCGACTTTGACCTGATCGTGCTGGATCTGA
TGTTGCCGGGGGTGGACGGGCTCACCATCTGCCGGGAGGTGCGCGCCGCCGGCATGACGCCGATCATCATGCTCACGGCC
AAGGCGGACGACATTGACAAGATCCTCGGCCTGGAACTGGGGGCCGACGACTACATCACCAAACCCTTCAACACGCGCGA
GCTCATCGCCCGCATCCGGGCCGTCCTGCGCCGGGCCGAGGCGGCCTCCCGGCAGGACCGGGCCGGCCGGCTGGTGGTGG
GCGACCTGGTGCTTCATCCCCGGCAGCGCCGGGCCGAGGTGGCCGGCCGGCCGCTGGAACTGACGGCCCGGGAGTACGAC
CTGCTGGAGCTGCTGGCCCGCCATCCCGGGGTGGTGTACACCCGCCAGGAGCTGCTGGACCTGGTGTGGGGCTACGACTT
TGCCGGTGACGAGCGAACCGTCGACGTCCACGTCCGGCGCATCCGGGAGAAGCTGGAGGAGGATCCCTCCCGGCCCCGGT
ACCTGCGCACCAAGTGGGGCGTGGGCTACTACCTGGAGGCCGAGCCGTGA

Protein sequence :
MPHILVVDDEPGLVKGLRLSLEQEGFQVTTASDGREALSKFRAGDFDLIVLDLMLPGVDGLTICREVRAAGMTPIIMLTA
KADDIDKILGLELGADDYITKPFNTRELIARIRAVLRRAEAASRQDRAGRLVVGDLVLHPRQRRAEVAGRPLELTAREYD
LLELLARHPGVVYTRQELLDLVWGYDFAGDERTVDVHVRRIREKLEEDPSRPRYLRTKWGVGYYLEAEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH2007 YP_075836.1 two-component response regulator NC_012469.1.7685629. Protein 7e-47 47
STH2007 YP_075836.1 two-component response regulator HE999704.1.gene2815. Protein 1e-40 46
STH2007 YP_075836.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-40 45
STH2007 YP_075836.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-40 45
STH2007 YP_075836.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-40 45
STH2007 YP_075836.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-40 45
STH2007 YP_075836.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-40 45
STH2007 YP_075836.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-40 45
STH2007 YP_075836.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-40 45
STH2007 YP_075836.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-40 45
STH2007 YP_075836.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-40 45
STH2007 YP_075836.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-40 45
STH2007 YP_075836.1 two-component response regulator NC_012469.1.7686381. Protein 4e-39 45
STH2007 YP_075836.1 two-component response regulator CP004022.1.gene3215. Protein 5e-28 44
STH2007 YP_075836.1 two-component response regulator AE016830.1.gene1681. Protein 6e-41 44
STH2007 YP_075836.1 two-component response regulator FJ349556.1.orf0.gene Protein 1e-36 44
STH2007 YP_075836.1 two-component response regulator AE000516.2.gene3505. Protein 1e-39 44
STH2007 YP_075836.1 two-component response regulator CP000034.1.gene3671. Protein 7e-34 42
STH2007 YP_075836.1 two-component response regulator NC_002951.3238224.p0 Protein 7e-36 41
STH2007 YP_075836.1 two-component response regulator NC_007793.3914065.p0 Protein 7e-36 41
STH2007 YP_075836.1 two-component response regulator NC_002758.1121390.p0 Protein 7e-36 41
STH2007 YP_075836.1 two-component response regulator NC_010079.5776364.p0 Protein 7e-36 41
STH2007 YP_075836.1 two-component response regulator NC_002952.2859858.p0 Protein 7e-36 41
STH2007 YP_075836.1 two-component response regulator NC_007622.3794948.p0 Protein 7e-36 41
STH2007 YP_075836.1 two-component response regulator NC_003923.1003417.p0 Protein 7e-36 41
STH2007 YP_075836.1 two-component response regulator NC_013450.8614146.p0 Protein 7e-36 41
STH2007 YP_075836.1 two-component response regulator CP000647.1.gene4257. Protein 2e-23 41
STH2007 YP_075836.1 two-component response regulator CP000034.1.gene3834. Protein 7e-24 41
STH2007 YP_075836.1 two-component response regulator CP001138.1.gene4273. Protein 3e-23 41
STH2007 YP_075836.1 two-component response regulator BAC0533 Protein 2e-23 41
STH2007 YP_075836.1 two-component response regulator NC_002695.1.915041.p Protein 7e-24 41
STH2007 YP_075836.1 two-component response regulator CP001918.1.gene5135. Protein 9e-20 41
STH2007 YP_075836.1 two-component response regulator NC_011595.7057856.p0 Protein 1e-31 41
STH2007 YP_075836.1 two-component response regulator NC_010410.6002989.p0 Protein 1e-31 41
STH2007 YP_075836.1 two-component response regulator HE999704.1.gene1528. Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH2007 YP_075836.1 two-component response regulator VFG1563 Protein 2e-36 43
STH2007 YP_075836.1 two-component response regulator VFG1702 Protein 2e-36 43
STH2007 YP_075836.1 two-component response regulator VFG1389 Protein 7e-29 42
STH2007 YP_075836.1 two-component response regulator VFG1390 Protein 6e-29 41
STH2007 YP_075836.1 two-component response regulator VFG1386 Protein 1e-29 41