Gene Information

Name : yfjY (YPTB3868)
Accession : YP_072346.1
Strain : Yersinia pseudotuberculosis IP 32953
Genome accession: NC_006155
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 4618494 - 4618973 bp
Length : 480 bp
Strand : -
Note : similar to Escherichia coli b2644 yfjY; hypothetical 18.0 kD protein in alpA-gabD intergenic region (61.6% evalue=9.E-50); Escherichia coli JW2625 yfjY, yfjZ; Hypothetical protein (o160) (61.6% evalue=9.E-50)

DNA sequence : 
ATGAACTTAACCTTATCCCCGGTGGTCACTGAACTACCATTAAGTACGCAGCGTACTGTCAAACGTGCTCTGTTCTTGCT
GGAAGCACATCTGCGTGAACCGGGGACCTCATTCACTTCACTCGGTACCGTCAGCGATTGGCTGCGATTGCGAATGGCTA
GACTGGATCGTGAAGTGTTTATGGTGCTCTGGCTCGACAATCAACACAGGCTGTTGGCCCACGAAACGTTGTTCACCGGC
AGTATCAACAGTACCGAGGTCCACCCCCGCGAAATCGTGAAAGCGGCACTGCAACACAATGCTGCAGCGGTGCTTCTGGC
GCATTGCCATCCCTCCGGCCACGCTGAGCCCAGTGTTGCCGACCGGCAAATCACCGGCAAGATTAAAGATGCACTGGCAC
TGGTTGAGGTCAGGATGCTGGATCACTGTATTGTCGGCGGCATGACGGTGTATTCGTTTGCTGAGCACGGCTTGTTATAG

Protein sequence : 
MNLTLSPVVTELPLSTQRTVKRALFLLEAHLREPGTSFTSLGTVSDWLRLRMARLDREVFMVLWLDNQHRLLAHETLFTG
SINSTEVHPREIVKAALQHNAAAVLLAHCHPSGHAEPSVADRQITGKIKDALALVEVRMLDHCIVGGMTVYSFAEHGLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 5e-35 64
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 4e-35 64
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 5e-35 64
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 5e-35 64
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 6e-35 63
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 5e-35 63
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 5e-35 63
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 5e-35 63
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 5e-35 63
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 5e-35 63
unnamed AAL08475.1 unknown Not tested SRL Protein 4e-35 63
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 2e-35 62
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 2e-33 61
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 1e-35 59
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 7e-36 58
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 1e-35 58
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 1e-35 58
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 8e-35 58
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 4e-35 58
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 2e-24 52
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-26 52
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-26 52
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 1e-26 52
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 8e-25 48
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 8e-23 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yfjY YP_072346.1 hypothetical protein VFG0660 Protein 1e-35 64
yfjY YP_072346.1 hypothetical protein VFG1528 Protein 3e-35 63
yfjY YP_072346.1 hypothetical protein VFG1066 Protein 2e-35 63
yfjY YP_072346.1 hypothetical protein VFG1678 Protein 7e-36 62
yfjY YP_072346.1 hypothetical protein VFG1617 Protein 2e-35 58
yfjY YP_072346.1 hypothetical protein VFG1119 Protein 5e-27 52