Name : yagB (YPTB3867) Accession : YP_072345.1 Strain : Yersinia pseudotuberculosis IP 32953 Genome accession: NC_006155 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 4618147 - 4618482 bp Length : 336 bp Strand : - Note : similar to Escherichia coli b0266 yagB; hypothetical 13.2 kD protein in perR-argF intergenic region (74.7% evalue=5.E-38); Escherichia coli JW0259 yagB; Hypothetical protein (74.7% evalue=5.E-38) DNA sequence : ATGCCATCAATCACTACCCCAGCCTGGGGACTTAAACGCAACGTCACTCCGCAGTTTGGTGCCCGTCTGGTACAGGAAGG CGACCGACTACATTTTCTAGCCGACCGTGCCGATATCAACGGAACCTTCAGCGAAGTGCAGGTACGTGATTTAGATAACG CCTTCCCGCAGTTCATCAACTACCTGGAACTGATGCTGCTCTCCGGTGAGCTCAACCCTCGCCACCAGCACTGTGTCACG TTGTATCGCAATGGCTTGACCTGTGAGGCCGATAGCCTGGGATCACACGGTTATGTGTATCTCGCTATTTATCCTACTCC CCAATCAACTGCATAA Protein sequence : MPSITTPAWGLKRNVTPQFGARLVQEGDRLHFLADRADINGTFSEVQVRDLDNAFPQFINYLELMLLSGELNPRHQHCVT LYRNGLTCEADSLGSHGYVYLAIYPTPQSTA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
yeeU | NP_838486.1 | structural protein | Not tested | SHI-1 | Protein | 4e-30 | 70 |
yeeU | NP_708772.1 | structural protein | Not tested | SHI-1 | Protein | 4e-30 | 70 |
unnamed | AAK00481.1 | unknown | Not tested | SHI-1 | Protein | 2e-30 | 70 |
ECO103_3591 | YP_003223448.1 | hypothetical protein | Not tested | LEE | Protein | 4e-28 | 70 |
unnamed | CAD66206.1 | hypothetical protein | Not tested | PAI III 536 | Protein | 1e-29 | 69 |
aec75 | AAW51758.1 | Aec75 | Not tested | AGI-3 | Protein | 1e-29 | 69 |
yeeU | YP_853121.1 | antitoxin of the YeeV-YeeU toxin-antitoxin system | Virulence | PAI IV APEC-O1 | Protein | 9e-29 | 69 |
yeeU | YP_854324.1 | hypothetical protein | Not tested | PAI I APEC-O1 | Protein | 1e-29 | 69 |
yeeU | AAZ04460.1 | conserved hypothetical protein | Not tested | PAI I APEC-O1 | Protein | 7e-30 | 69 |
yeeU | CAD42100.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 4e-29 | 68 |
yeeU | ADD91700.1 | YeeU | Not tested | PAI-I AL862 | Protein | 1e-28 | 68 |
yeeU | CAE85203.1 | YeeU protein | Not tested | PAI V 536 | Protein | 9e-30 | 68 |
c5150 | NP_756998.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 7e-29 | 68 |
Z1658 | NP_287161.1 | structural protein | Not tested | TAI | Protein | 2e-27 | 67 |
Z1220 | NP_286755.1 | structural protein | Not tested | TAI | Protein | 2e-27 | 67 |
unnamed | AAL08477.1 | unknown | Not tested | SRL | Protein | 1e-27 | 64 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
yagB | YP_072345.1 | hypothetical protein | VFG0662 | Protein | 1e-30 | 70 |
yagB | YP_072345.1 | hypothetical protein | VFG1681 | Protein | 6e-30 | 69 |
yagB | YP_072345.1 | hypothetical protein | VFG1619 | Protein | 2e-29 | 68 |
yagB | YP_072345.1 | hypothetical protein | VFG1068 | Protein | 5e-28 | 64 |