Gene Information

Name : terE (YPTB0357)
Accession : YP_068903.1
Strain : Yersinia pseudotuberculosis IP 32953
Genome accession: NC_006155
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 422035 - 422610 bp
Length : 576 bp
Strand : +
Note : similar to Yersinia pestis YPO0299 terE; tellurium resistance protein (100% evalue=1.E-105); Escherichia coli Z1615 terE_2; phage inhibition, colicin resistance and tellurite resistance protein (85.3% evalue=4.E-91)

DNA sequence :
ATGGCAGTTTCTCTGGTAAAAGGTGGTAACGTATCTCTGACAAAAGAAGCTCCAACCATGAACATTGCTGTCGTGGGGCT
GGGTTGGGATGCACGTGTGACCGATGGTTCTGAATTTGACCTTGATGCCTCGGTATTTATGGTCGGTGAAAACGGCAAAG
TTTTGTCTGATCAGCACTTCATCTTCTTTAACAACAAAGTGAGTCCTTGTGGTTCTGTTGTTCATCAGGGTGATAACCGT
ACCGGTGCTGGTGACGGTGACGATGAGCAGATCAAAATTGATCTGAAAAAAGTCCCAGCTGACGTGAAGAAAATTATTTT
CTCAGTCACCATTTATGATGCTGAAGCCCGTAAGCAAAACTTTGGTATGGTCAGCAACAGCTTCATGCGTGTGGTCAACG
AAGATAACAGCGCAGAAATTGCTCGCTTTGACCTATCCGAGGATGCCAGTACTGAAACCGCCATGATCTTTGGCGAGCTA
TACCGCAATAATGACGAATGGAAATTTAAAGCTGTCGGTCAGGGTTTTGCCGGTGGTCTGTCTGCGCTGGCAAGCCAGCA
TGGTGTGTCGGTATAA

Protein sequence :
MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDASVFMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNR
TGAGDGDDEQIKIDLKKVPADVKKIIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGEL
YRNNDEWKFKAVGQGFAGGLSALASQHGVSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-74 86
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-74 86
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-74 86
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-63 71
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE YP_068903.1 tellurium resistance protein BAC0390 Protein 2e-74 81
terE YP_068903.1 tellurium resistance protein BAC0389 Protein 2e-58 65