Gene Information

Name : ogrK (YPTB1834)
Accession : YP_070360.1
Strain : Yersinia pseudotuberculosis IP 32953
Genome accession: NC_006155
Putative virulence/resistance : Unknown
Product : prophage p2 Ogr protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2185864 - 2186037 bp
Length : 174 bp
Strand : -
Note : similar to Salmonella typhi STY3703 positive regulator of late gene transcription (66% evalue=6.E-16); Escherichia coli JW2067 ogrK; Ogr protein (62.5% evalue=6.E-16)

DNA sequence : 
ATGTTCAATTGCCCTTTATGCCATCAGGCAGCACACACCCGCAGCAGTAGCCAGGTAACCACCGAAACCAAAGAGCGCTA
TCACCAGTGCACCAATGTGAATTGTGGCCATACATTCGTAACGATGGAAAGTTTTATGCGTTCTATATCGAAGCCCGGCG
AGATTAACCGGTGA

Protein sequence : 
MFNCPLCHQAAHTRSSSQVTTETKERYHQCTNVNCGHTFVTMESFMRSISKPGEINR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
STY4600 NP_458683.1 putative positive regulator of late gene transcription Not tested SPI-7 Protein 5e-09 61
t4294 NP_807891.1 positive regulator of late gene transcription Not tested SPI-7 Protein 5e-09 61