
|
Name : ACIAD0320 (ACIAD0320) Accession : YP_045101.1 Strain : Acinetobacter sp. ADP1 Genome accession: NC_005966 Putative virulence/resistance : Unknown Product : IS1236 transposase protein 1 Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 321630 - 321938 bp Length : 309 bp Strand : + Note : Evidence 1 : Function experimentally demonstrated in the studied organism; PubMedId : 8757745; Product type e : enzyme DNA sequence : TTGGAGATCCAAGAAATGGCCAAACGTTTTAGTCCTGAATTTAAACAGCAAGCAATTGATTATGCACTTTCAAACTCACA CGAGCCTATAGCTACAATCGCCCAGAAATTAGGTGTGGGTTATTCAACTTTAGACAAATGGATTCGTGAAGCCAATCCAG TGGGTTCAAGCAAACGTCAACTTTCACCAGAACAACAGCGGATCTTGGAATTAGAGAAAGAAGTCAAACAGCTCAGGGAA GCCAATGACATCTTAAAAAAAGCGCATGTGTACTTTCTGACAGATCATGCCAAGAAAAGTACACGGTAA Protein sequence : MEIQEMAKRFSPEFKQQAIDYALSNSHEPIATIAQKLGVGYSTLDKWIREANPVGSSKRQLSPEQQRILELEKEVKQLRE ANDILKKAHVYFLTDHAKKSTR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ECO103_3584 | YP_003223442.1 | IS629 transposase OrfA | Not tested | LEE | Protein | 4e-09 | 42 |
| IS629 | CAC37925.1 | hypothetical protein | Not tested | LEE | Protein | 3e-09 | 42 |
| ECO111_3720 | YP_003236060.1 | putative IS629 transposase OrfA | Not tested | LEE | Protein | 2e-08 | 42 |
| IS629 | CAI43820.1 | hypothetical protein | Not tested | LEE | Protein | 3e-09 | 42 |
| ECO111_3775 | YP_003236110.1 | putative IS629 transposase OrfA | Not tested | LEE | Protein | 2e-08 | 42 |
| IS629 | CAI43841.1 | hypothetical protein | Not tested | LEE | Protein | 3e-09 | 42 |
| Z4335 | NP_289560.1 | hypothetical protein | Not tested | OI-122 | Protein | 2e-08 | 42 |
| IS629 | CAI43908.1 | hypothetical protein 1 | Not tested | LEE | Protein | 3e-09 | 42 |
| Z1199 | NP_286734.1 | hypothetical protein | Not tested | TAI | Protein | 8e-09 | 41 |
| Z1222 | NP_286757.1 | hypothetical protein | Not tested | TAI | Protein | 8e-09 | 41 |
| Z1639 | NP_287142.1 | hypothetical protein | Not tested | TAI | Protein | 8e-09 | 41 |
| Z1661 | NP_287163.1 | hypothetical protein | Not tested | TAI | Protein | 8e-09 | 41 |