Gene Information

Name : terE (ACIAD1955)
Accession : YP_046603.1
Strain : Acinetobacter sp. ADP1
Genome accession: NC_005966
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1942195 - 1942770 bp
Length : 576 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type ph : phenotype

DNA sequence :
ATGGCAATTAGTTTAACCAAAGGCGGCAACGTTAGCTTAACCAAAGAAGCGCCAGGCATTACGAAAACAACTGTAGGCTT
GGGTTGGAACCCGCGTGTAACCGATGGTGCAGCCTTTGACCTTGATGCAATTGCATTTTTGGTGAATGAAAGTGGTAAGG
TACGTGCTGACAATGACTTTATTTTCTTTAATAACTTAAAGTCATCTGATGGTTCAGTGGTTCACAATGGTGATAACCGT
ACAGGTGAAGGCGATGGGGATGATGAGACGTTAAGCATTGACTTAAGCAAAGTACCTACCGATGTGGCTAAAGTCATTTT
TGCGGTTACTATTTATGACGGGCAAGCCCGTAATCAAAACTTTGGTCAAGTGGCGAATGCCTATATTCGTGTCATTAACG
ATACGGGCGGTAGTGAAATCGCACGTTATGACTTGTCTGAAGACAGTAGTACTGAAACGGCAATGATCTTTGGTGAACTT
TATAAACATGGTAGTGAGTGGAAATTCCGCGCAATAGGTCAAGGTTTTGCTGGTGGCTTAGGGCCTTTAGCAGCGTCTTA
TGGTGTTTCTGTTTAA

Protein sequence :
MAISLTKGGNVSLTKEAPGITKTTVGLGWNPRVTDGAAFDLDAIAFLVNESGKVRADNDFIFFNNLKSSDGSVVHNGDNR
TGEGDGDDETLSIDLSKVPTDVAKVIFAVTIYDGQARNQNFGQVANAYIRVINDTGGSEIARYDLSEDSSTETAMIFGEL
YKHGSEWKFRAIGQGFAGGLGPLAASYGVSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-66 70
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-62 68
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-62 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-62 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-60 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-63 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-63 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-63 65

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE YP_046603.1 tellurium resistance protein BAC0390 Protein 2e-63 66
terE YP_046603.1 tellurium resistance protein BAC0389 Protein 5e-63 65