Gene Information

Name : BT9727_4272 (BT9727_4272)
Accession : YP_038587.1
Strain : Bacillus thuringiensis 97-27
Genome accession: NC_005957
Putative virulence/resistance : Resistance
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4334502 - 4335194 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGTCACATCATATTTTATTAGTTGAAGATGATCTCTCAATTCAAGAGATGGTGGAAAAGTATTTAGTGAAGGAAGGCTT
TCAAGTTACAATTGCATCTGACGGAGAAGAAGGGGTAAACACATATTTAAAAGGTTCATTTGATTTGATTATCCTCGACA
TTATGATGCCAAAGCTAGATGGCTTAGAGGTTGTACGTATTATTCGTGAAAAAAGTGCCGTTCCGATTTTAATGATGTCA
GCAAAAGATACAGATGTTGATAAAGCTGTTGGATTAGGACTTGGAGCAGATGATTACATTTGTAAGCCATTTTCTATGAT
TGAATTAGCTGCACGTGTAAAGGCGGGTATTCGAAGATCTACGAAATATTCGGCTACAGAAACAACAGAAAAGATGATTC
AAATTGGTGATTTAACGATTGATCCAATTAATTTTACTGTGGAAAAAAACGGAAAGCCTCTCAAACTGACTTTAAAAGAA
TTTGAGATTCTAAAACTGTTTGTAAAGAATCAAAATCGTGTATTTACAAAGGCACAAATATATACGCTAATTTGGAACGA
AGAGTATTACGGTGACGATAACGTTATTAATGTTCATATGAGAAGGTTGCGTGAGAAAATCGAAAGTGATCCATCTAATC
CAGAATATATTAAAACGTTATGGGGCATCGGCTATAAGCTGGAAGTGATGTAA

Protein sequence :
MSHHILLVEDDLSIQEMVEKYLVKEGFQVTIASDGEEGVNTYLKGSFDLIILDIMMPKLDGLEVVRIIREKSAVPILMMS
AKDTDVDKAVGLGLGADDYICKPFSMIELAARVKAGIRRSTKYSATETTEKMIQIGDLTIDPINFTVEKNGKPLKLTLKE
FEILKLFVKNQNRVFTKAQIYTLIWNEEYYGDDNVINVHMRRLREKIESDPSNPEYIKTLWGIGYKLEVM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BT9727_4272 YP_038587.1 response regulator AF155139.2.orf0.gene Protein 1e-45 47
BT9727_4272 YP_038587.1 response regulator NC_012469.1.7685629. Protein 5e-45 46
BT9727_4272 YP_038587.1 response regulator NC_014475.1.orf0.gen Protein 3e-43 44
BT9727_4272 YP_038587.1 response regulator NC_005054.2598277.p0 Protein 3e-43 44
BT9727_4272 YP_038587.1 response regulator NC_002952.2859905.p0 Protein 6e-43 44
BT9727_4272 YP_038587.1 response regulator NC_013450.8614421.p0 Protein 8e-43 44
BT9727_4272 YP_038587.1 response regulator NC_007793.3914279.p0 Protein 8e-43 44
BT9727_4272 YP_038587.1 response regulator NC_002745.1124361.p0 Protein 8e-43 44
BT9727_4272 YP_038587.1 response regulator NC_009782.5559369.p0 Protein 8e-43 44
BT9727_4272 YP_038587.1 response regulator NC_002951.3237708.p0 Protein 8e-43 44
BT9727_4272 YP_038587.1 response regulator NC_003923.1003749.p0 Protein 7e-43 44
BT9727_4272 YP_038587.1 response regulator NC_002758.1121668.p0 Protein 8e-43 44
BT9727_4272 YP_038587.1 response regulator NC_007622.3794472.p0 Protein 6e-43 44
BT9727_4272 YP_038587.1 response regulator NC_009641.5332272.p0 Protein 8e-43 44
BT9727_4272 YP_038587.1 response regulator HE999704.1.gene2815. Protein 3e-42 44
BT9727_4272 YP_038587.1 response regulator FJ349556.1.orf0.gene Protein 2e-43 43
BT9727_4272 YP_038587.1 response regulator BAC0308 Protein 7e-36 42
BT9727_4272 YP_038587.1 response regulator AE016830.1.gene1681. Protein 1e-40 42
BT9727_4272 YP_038587.1 response regulator AF310956.2.orf0.gene Protein 4e-36 41