Gene Information

Name : BT9727_0242 (BT9727_0242)
Accession : YP_034596.1
Strain : Bacillus thuringiensis 97-27
Genome accession: NC_005957
Putative virulence/resistance : Resistance
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 270237 - 270938 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
GTGGCACACGAAACAATACTTGTCGTAGATGATGAAAAAGAAATCCGAAATTTAATTACAATCTATTTAAAGAATGAAGG
ATATAAAGTATTGCAAGCAGGAGACGGAGAAGAAGGATTACGTCTCCTGGAAGAAAATGAAGTACATCTAGTCGTATTAG
ATATTATGATGCCGAAAGTAGACGGCATTCATATGTGTATGAAAGTAAGGGAAGAAAAAGAAATGCCAATTATTATGCTT
TCAGCGAAAACGCAAGATATGGATAAGATTTTAGGATTAACAACGGGTGCAGATGATTACGTAACGAAACCGTTTAATCC
GTTAGAGTTAATCGCAAGAATTAAATCTCAGTTACGCCGTTATATGAAAATGAATGGTTTCGCTATACAAAATGAGGACG
AGCTAGAGATTGGGGAGATGAAAATAAACATATCAACCCATAAAGTCATTGTAGAGGGAGAAGAAGTGAAATTAACTCCG
AGGGAATTTTCAATTTTAGAATTGCTAGCCCGTAATCCGGGGATGGTCTTTAGCGCGGAGCAAATTTATGAAAAGGTTTG
GAACGAACGATCTTTCCAGTCGGATAACACGGTAATGGTGCATATTCGAAAAGTACGTGAAAAGATTGAGGAGAATCCAA
GGAAACCTAGATATATAAAAACGGTATGGGGAGTGGGGTATAAGATTGAAAAAGATATTTAA

Protein sequence :
MAHETILVVDDEKEIRNLITIYLKNEGYKVLQAGDGEEGLRLLEENEVHLVVLDIMMPKVDGIHMCMKVREEKEMPIIML
SAKTQDMDKILGLTTGADDYVTKPFNPLELIARIKSQLRRYMKMNGFAIQNEDELEIGEMKINISTHKVIVEGEEVKLTP
REFSILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPRYIKTVWGVGYKIEKDI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 2e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BT9727_0242 YP_034596.1 response regulator AM180355.1.gene1830. Protein 3e-52 54
BT9727_0242 YP_034596.1 response regulator DQ212986.1.gene4.p01 Protein 1e-50 54
BT9727_0242 YP_034596.1 response regulator AF130997.1.orf0.gene Protein 4e-51 53
BT9727_0242 YP_034596.1 response regulator AF155139.2.orf0.gene Protein 1e-52 50
BT9727_0242 YP_034596.1 response regulator NC_014475.1.orf0.gen Protein 2e-50 50
BT9727_0242 YP_034596.1 response regulator AF162694.1.orf4.gene Protein 4e-46 50
BT9727_0242 YP_034596.1 response regulator NC_005054.2598277.p0 Protein 2e-50 50
BT9727_0242 YP_034596.1 response regulator FJ349556.1.orf0.gene Protein 3e-48 49
BT9727_0242 YP_034596.1 response regulator EU250284.1.orf4.gene Protein 7e-44 47
BT9727_0242 YP_034596.1 response regulator AF253562.2.orf0.gene Protein 2e-32 47
BT9727_0242 YP_034596.1 response regulator NC_002952.2859905.p0 Protein 7e-36 43
BT9727_0242 YP_034596.1 response regulator NC_013450.8614421.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_007793.3914279.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_003923.1003749.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_002745.1124361.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_009782.5559369.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_002951.3237708.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_007622.3794472.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_002758.1121668.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_009641.5332272.p0 Protein 6e-36 43
BT9727_0242 YP_034596.1 response regulator NC_012469.1.7685629. Protein 1e-33 43
BT9727_0242 YP_034596.1 response regulator HE999704.1.gene2815. Protein 4e-36 42
BT9727_0242 YP_034596.1 response regulator AE000516.2.gene3505. Protein 3e-33 41