Gene Information

Name : sugE (pc0715)
Accession : YP_007714.1
Strain : Candidatus Protochlamydia amoebophila UWE25
Genome accession: NC_005861
Putative virulence/resistance : Resistance
Product : sugE protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 869993 - 870325 bp
Length : 333 bp
Strand : -
Note : strongly similar to sugE protein

DNA sequence :
TTGTTGAGATTTAATTTGGGCTGGATATATTTATTGATTGCTGGTTTATTTGAAATAGGGTTTACGACTTTTCTTAAGTT
GTCTAATAATTTTACTCGTCTATGGCCAACAGCTATTTTTTTTATTTTCTCGGTTTGCAGCTTTTTAGCACTTTCCTTAA
GCTTAAAAACTATTCCATTAGGAACAGCTTATGCTATTTGGACTGGCATGGGAGCAGTGGGAACAGCTGTGATTGGTATT
CTTTATTTTGGCGAGTCTATAGATTTTTGGCGTTTATTTTTTCTTGTCTGTCTTATTATTTCTATCATCGGACTTAAAAT
ATCTTCTGCATAA

Protein sequence :
MLRFNLGWIYLLIAGLFEIGFTTFLKLSNNFTRLWPTAIFFIFSVCSFLALSLSLKTIPLGTAYAIWTGMGAVGTAVIGI
LYFGESIDFWRLFFLVCLIISIIGLKISSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-08 45
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-08 45
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-08 45
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-08 45
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-08 45
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-08 45
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-08 45
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-08 45
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-08 45
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-08 45
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-08 45
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-08 45
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-08 45
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-08 45
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-08 45
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-08 45
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-08 45
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-08 45
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-08 45
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-08 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sugE YP_007714.1 sugE protein BAC0378 Protein 7e-12 45
sugE YP_007714.1 sugE protein BAC0322 Protein 4e-09 45
sugE YP_007714.1 sugE protein BAC0323 Protein 5e-09 45
sugE YP_007714.1 sugE protein BAC0140 Protein 4e-09 44
sugE YP_007714.1 sugE protein BAC0150 Protein 3e-06 44
sugE YP_007714.1 sugE protein NC_002695.1.913273.p Protein 3e-06 44
sugE YP_007714.1 sugE protein BAC0324 Protein 2e-08 42
sugE YP_007714.1 sugE protein CP004022.1.gene1549. Protein 2e-07 42
sugE YP_007714.1 sugE protein CP001138.1.gene1489. Protein 8e-07 42
sugE YP_007714.1 sugE protein BAC0449 Protein 5e-09 41
sugE YP_007714.1 sugE protein BAC0325 Protein 8e-10 41