Gene Information

Name : TTC1138 (TTC1138)
Accession : YP_005107.1
Strain : Thermus thermophilus HB27
Genome accession: NC_005835
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1107998 - 1108681 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGGGAGGCATGGAGCCGCCCCTGATCCTCATCGTGGAGGACGAGAAGGACATCGCCCGCTTCATTGAGCTTGAGCTCCA
GGCCGAGGGCTACCGCACCGAGGTGGCCCACGACGGGATCACCGGGCTTTCCAAGTTCCGGGAGGTGAGCCCCAACCTGG
TGATCCTGGACCTGATGCTCCCCGTGATGGACGGGATTGAGGTGGCCAAGCGCATCCGCAAGACCTCCAACGTCCCCATC
CTCATCCTCACCGCCAAGGACCGCGTGGAGGACAAGGTGGCGGGCCTGGACGCGGGGGCCGACGACTACCTGGTGAAGCC
CTTCTCCATAGAGGAGCTCCTCGCCCGGGTCAGGGCCCACCTCCGCCGGGTCACCCCGGCCATCACCGGGGAGATCCGGG
TGGCGGACCTCATCATCAACCTCGAGGGCCGGGAGGTCTTCCGGGGAAACCGCCGCATTGAACTCTCCAACAAGGAGTTT
GAGCTTCTGGAGCTCCTCGCCAAAAACCCCGGCAAGGTCTTCAGCCGCTACGAGATTGAGGAGAAGGTCTGGCCCGGCTA
CCAAGGGGGAAGCAACGTGGTGGACGTCTACATCGGCTACCTGCGCAAGAAGCTGGAGGCCGGGGGGGAGCGCCGCCTCA
TCCACACGGTGCGGGGCGTGGGGTACGTCCTCAGGGAGGACTGA

Protein sequence :
MGGMEPPLILIVEDEKDIARFIELELQAEGYRTEVAHDGITGLSKFREVSPNLVILDLMLPVMDGIEVAKRIRKTSNVPI
LILTAKDRVEDKVAGLDAGADDYLVKPFSIEELLARVRAHLRRVTPAITGEIRVADLIINLEGREVFRGNRRIELSNKEF
ELLELLAKNPGKVFSRYEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAGGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-29 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-26 41
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 2e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TTC1138 YP_005107.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-36 51
TTC1138 YP_005107.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-36 51
TTC1138 YP_005107.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-36 51
TTC1138 YP_005107.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-36 51
TTC1138 YP_005107.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-36 51
TTC1138 YP_005107.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-36 51
TTC1138 YP_005107.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-36 51
TTC1138 YP_005107.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-36 51
TTC1138 YP_005107.1 two-component response regulator HE999704.1.gene1528. Protein 1e-39 50
TTC1138 YP_005107.1 two-component response regulator BAC0125 Protein 2e-39 49
TTC1138 YP_005107.1 two-component response regulator AE015929.1.gene1106. Protein 3e-33 46
TTC1138 YP_005107.1 two-component response regulator NC_012469.1.7685629. Protein 9e-30 46
TTC1138 YP_005107.1 two-component response regulator BAC0308 Protein 1e-35 44
TTC1138 YP_005107.1 two-component response regulator BAC0197 Protein 1e-32 44
TTC1138 YP_005107.1 two-component response regulator AE000516.2.gene3505. Protein 3e-33 44
TTC1138 YP_005107.1 two-component response regulator BAC0111 Protein 1e-33 43
TTC1138 YP_005107.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_003923.1003749.p0 Protein 6e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-31 43
TTC1138 YP_005107.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-31 43
TTC1138 YP_005107.1 two-component response regulator BAC0638 Protein 1e-27 43
TTC1138 YP_005107.1 two-component response regulator AF155139.2.orf0.gene Protein 2e-30 42
TTC1138 YP_005107.1 two-component response regulator BAC0347 Protein 1e-28 42
TTC1138 YP_005107.1 two-component response regulator BAC0083 Protein 1e-33 42
TTC1138 YP_005107.1 two-component response regulator Y16952.3.orf35.gene. Protein 2e-21 41
TTC1138 YP_005107.1 two-component response regulator HE999704.1.gene2815. Protein 2e-31 41
TTC1138 YP_005107.1 two-component response regulator U82965.2.orf14.gene. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TTC1138 YP_005107.1 two-component response regulator VFG1390 Protein 1e-45 51
TTC1138 YP_005107.1 two-component response regulator VFG1389 Protein 6e-36 44
TTC1138 YP_005107.1 two-component response regulator VFG0596 Protein 2e-30 43
TTC1138 YP_005107.1 two-component response regulator VFG1386 Protein 1e-35 43
TTC1138 YP_005107.1 two-component response regulator VFG1563 Protein 5e-27 42
TTC1138 YP_005107.1 two-component response regulator VFG1702 Protein 5e-27 41