
|
Name : TTC1138 (TTC1138) Accession : YP_005107.1 Strain : Thermus thermophilus HB27 Genome accession: NC_005835 Putative virulence/resistance : Resistance Product : two-component response regulator Function : - COG functional category : T : Signal transduction mechanisms COG ID : COG0745 EC number : - Position : 1107998 - 1108681 bp Length : 684 bp Strand : + Note : - DNA sequence : ATGGGAGGCATGGAGCCGCCCCTGATCCTCATCGTGGAGGACGAGAAGGACATCGCCCGCTTCATTGAGCTTGAGCTCCA GGCCGAGGGCTACCGCACCGAGGTGGCCCACGACGGGATCACCGGGCTTTCCAAGTTCCGGGAGGTGAGCCCCAACCTGG TGATCCTGGACCTGATGCTCCCCGTGATGGACGGGATTGAGGTGGCCAAGCGCATCCGCAAGACCTCCAACGTCCCCATC CTCATCCTCACCGCCAAGGACCGCGTGGAGGACAAGGTGGCGGGCCTGGACGCGGGGGCCGACGACTACCTGGTGAAGCC CTTCTCCATAGAGGAGCTCCTCGCCCGGGTCAGGGCCCACCTCCGCCGGGTCACCCCGGCCATCACCGGGGAGATCCGGG TGGCGGACCTCATCATCAACCTCGAGGGCCGGGAGGTCTTCCGGGGAAACCGCCGCATTGAACTCTCCAACAAGGAGTTT GAGCTTCTGGAGCTCCTCGCCAAAAACCCCGGCAAGGTCTTCAGCCGCTACGAGATTGAGGAGAAGGTCTGGCCCGGCTA CCAAGGGGGAAGCAACGTGGTGGACGTCTACATCGGCTACCTGCGCAAGAAGCTGGAGGCCGGGGGGGAGCGCCGCCTCA TCCACACGGTGCGGGGCGTGGGGTACGTCCTCAGGGAGGACTGA Protein sequence : MGGMEPPLILIVEDEKDIARFIELELQAEGYRTEVAHDGITGLSKFREVSPNLVILDLMLPVMDGIEVAKRIRKTSNVPI LILTAKDRVEDKVAGLDAGADDYLVKPFSIEELLARVRAHLRRVTPAITGEIRVADLIINLEGREVFRGNRRIELSNKEF ELLELLAKNPGKVFSRYEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAGGERRLIHTVRGVGYVLRED |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| copR | NP_460069.2 | transcriptional regulatory protein YedW | Not tested | SPI-5 | Protein | 4e-30 | 43 |
| unnamed | CAD42044.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 9e-27 | 42 |
| copR | AAC33719.1 | regulatory protein CopR | Not tested | SPI-5 | Protein | 2e-29 | 42 |
| c3565 | NP_755440.1 | response regulator | Not tested | PAI I CFT073 | Protein | 1e-26 | 41 |
| nisR2 | YP_006309922.1 | NisR | Not tested | FWisland_1 | Protein | 2e-20 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_002952.2859858.p0 | Protein | 2e-36 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_007622.3794948.p0 | Protein | 2e-36 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_003923.1003417.p0 | Protein | 2e-36 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_013450.8614146.p0 | Protein | 2e-36 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_002951.3238224.p0 | Protein | 2e-36 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_007793.3914065.p0 | Protein | 2e-36 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_002758.1121390.p0 | Protein | 2e-36 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_010079.5776364.p0 | Protein | 2e-36 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | HE999704.1.gene1528. | Protein | 1e-39 | 50 |
| TTC1138 | YP_005107.1 | two-component response regulator | BAC0125 | Protein | 2e-39 | 49 |
| TTC1138 | YP_005107.1 | two-component response regulator | AE015929.1.gene1106. | Protein | 3e-33 | 46 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_012469.1.7685629. | Protein | 9e-30 | 46 |
| TTC1138 | YP_005107.1 | two-component response regulator | BAC0308 | Protein | 1e-35 | 44 |
| TTC1138 | YP_005107.1 | two-component response regulator | BAC0197 | Protein | 1e-32 | 44 |
| TTC1138 | YP_005107.1 | two-component response regulator | AE000516.2.gene3505. | Protein | 3e-33 | 44 |
| TTC1138 | YP_005107.1 | two-component response regulator | BAC0111 | Protein | 1e-33 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_002952.2859905.p0 | Protein | 4e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_013450.8614421.p0 | Protein | 5e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_007793.3914279.p0 | Protein | 5e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_003923.1003749.p0 | Protein | 6e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_007622.3794472.p0 | Protein | 4e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_002745.1124361.p0 | Protein | 5e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_009782.5559369.p0 | Protein | 5e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_002951.3237708.p0 | Protein | 5e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_002758.1121668.p0 | Protein | 5e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | NC_009641.5332272.p0 | Protein | 5e-31 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | BAC0638 | Protein | 1e-27 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | AF155139.2.orf0.gene | Protein | 2e-30 | 42 |
| TTC1138 | YP_005107.1 | two-component response regulator | BAC0347 | Protein | 1e-28 | 42 |
| TTC1138 | YP_005107.1 | two-component response regulator | BAC0083 | Protein | 1e-33 | 42 |
| TTC1138 | YP_005107.1 | two-component response regulator | Y16952.3.orf35.gene. | Protein | 2e-21 | 41 |
| TTC1138 | YP_005107.1 | two-component response regulator | HE999704.1.gene2815. | Protein | 2e-31 | 41 |
| TTC1138 | YP_005107.1 | two-component response regulator | U82965.2.orf14.gene. | Protein | 2e-20 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| TTC1138 | YP_005107.1 | two-component response regulator | VFG1390 | Protein | 1e-45 | 51 |
| TTC1138 | YP_005107.1 | two-component response regulator | VFG1389 | Protein | 6e-36 | 44 |
| TTC1138 | YP_005107.1 | two-component response regulator | VFG0596 | Protein | 2e-30 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | VFG1386 | Protein | 1e-35 | 43 |
| TTC1138 | YP_005107.1 | two-component response regulator | VFG1563 | Protein | 5e-27 | 42 |
| TTC1138 | YP_005107.1 | two-component response regulator | VFG1702 | Protein | 5e-27 | 41 |