|
Name : YP_pCD71 (YP_pCD71) Accession : NP_995393.1 Strain : Genome accession: NC_005813 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 50499 - 50822 bp Length : 324 bp Strand : + Note : Best Blastp hit = gi|16082706|ref|NP_395152.1| (NC_003131) hypothetical protein YPCD1.16c (107 aa) [Yersinia pestis] gi|11354280|pir||T42903 hypothetical protein Y0068 - Yersinia pestis plasmid pCD1, gi|3822091|gb|AAC6981 1.1| (AF074612) unknown [Yersinia DNA sequence : TTGATAATGACTCAACCTAAACAGACCAAACGCCGTTTTTCTCCTGAATTCAAACTGGAAGCTATTGAGCAGGTCGTTAA GTATCAGCGGTCAACCATCGAGGTTGCACGCGCTCTGGAGCTGGATCCCAGCCAATTGCGTAAATGGATACGCCAGTACA AAGAAGAAGTCAGCGGGATGACGCCGGACAATCCTGCACTGACACCAGAGCAACGTGAAATCCAGTCGCTCAGGGCGCAG ATTAAACGGCTGGAAATGGAAAAAGAAATACTAAAGCAGGCAGCTGTGTTGATGAGCGAGTTCCCCATCAAATCTTTGCG TTAA Protein sequence : MIMTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLRKWIRQYKEEVSGMTPDNPALTPEQREIQSLRAQ IKRLEMEKEILKQAAVLMSEFPIKSLR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 1e-29 | 71 |
| unnamed | CAD33780.1 | putative transposase | Not tested | PAI I 536 | Protein | 1e-28 | 70 |
| RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 9e-14 | 49 |
| orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-14 | 46 |
| VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 8e-14 | 46 |
| unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-14 | 46 |
| orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 8e-14 | 46 |
| orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-14 | 46 |
| orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-14 | 46 |
| orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-14 | 46 |
| VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 6e-14 | 46 |
| l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 6e-14 | 42 |
| orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 6e-14 | 42 |
| api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 3e-12 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| YP_pCD71 | NP_995393.1 | hypothetical protein | VFG1566 | Protein | 4e-30 | 71 |
| YP_pCD71 | NP_995393.1 | hypothetical protein | VFG1521 | Protein | 5e-29 | 70 |
| YP_pCD71 | NP_995393.1 | hypothetical protein | VFG1123 | Protein | 2e-14 | 46 |
| YP_pCD71 | NP_995393.1 | hypothetical protein | VFG1485 | Protein | 3e-14 | 42 |
