Name : YP_pCD98 (YP_pCD98) Accession : NP_995414.1 Strain : Genome accession: NC_005813 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 69803 - 70126 bp Length : 324 bp Strand : + Note : Best Blastp hit =gi|16082769|ref|NP_395215.1| (NC_003131) hypothetical protein YPCD1.83c [Yersinia pestis] gi|11354286|pir||T42918 hypothetical protein Y0094 - Yersinia pestis plasmid pCD1, gi|3822106|gb|AAC6982 6.1| (AF074612) unknown [Yersinia pestis] g DNA sequence : TTGATAATGACTCAACCTAAACAGACCAAACGCCGTTTTTCTCCTGAATTCAAACTGGAAGCTATTGAGCAGGTCGTTAA GTATCAGCGGTCAACCATCGAGGTTGCACGCGCTCTGGAGCTGGATCCCAGCCAATTGCGTAAATGGATACGCCAGTACA AAGAAGAAGTCAGCGGGGTGACGCCGGACAATCCTGCACTGACACCAGAGCAACGTGAAATCCAGTCGCTCAGGGCGCAG ATTAAACGGCTGGAAATGGAAAAAGAAATACTAAAGCAGGCAGCCGTGTTGATGAGCGAGTTCCCCATCAAATCTTTGCG TTAA Protein sequence : MIMTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLRKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQ IKRLEMEKEILKQAAVLMSEFPIKSLR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 6e-30 | 71 |
unnamed | CAD33780.1 | putative transposase | Not tested | PAI I 536 | Protein | 8e-29 | 70 |
RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 4e-14 | 50 |
orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 46 |
VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 1e-13 | 46 |
orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 46 |
unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 46 |
VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 2e-13 | 46 |
orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 46 |
orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 2e-13 | 46 |
orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-13 | 46 |
l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 1e-13 | 42 |
orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 1e-13 | 42 |
api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 7e-12 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
YP_pCD98 | NP_995414.1 | hypothetical protein | VFG1566 | Protein | 2e-30 | 71 |
YP_pCD98 | NP_995414.1 | hypothetical protein | VFG1521 | Protein | 3e-29 | 70 |
YP_pCD98 | NP_995414.1 | hypothetical protein | VFG1123 | Protein | 4e-14 | 46 |
YP_pCD98 | NP_995414.1 | hypothetical protein | VFG1485 | Protein | 5e-14 | 42 |