Gene Information

Name : rpmJ (YP_0796)
Accession : NP_992184.1
Strain : Yersinia pestis 91001
Genome accession: NC_005810
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L36
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0257
EC number : -
Position : 859611 - 859754 bp
Length : 144 bp
Strand : -
Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io

DNA sequence :
ATGCAAGTATTAAGTTCATTACGTTCGGCAAAGAACCGCCATCCAGACTGCAAGATTGTCCGTCGCCGTGGCCGAGTGTA
CGTAATTTGCAAAAGCAACCCTCGCTTTAAAGCGGTTCAGGGAGGAACCCATAAAAAACGCTGA

Protein sequence :
MQVLSSLRSAKNRHPDCKIVRRRGRVYVICKSNPRFKAVQGGTHKKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmJ YP_001800879.1 50S ribosomal protein L36 Not tested Not named Protein 4e-05 61