Gene Information

Name : terD (PSPPH_0837)
Accession : YP_273118.1
Strain : Pseudomonas syringae 1448A
Genome accession: NC_005773
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 999689 - 1000264 bp
Length : 576 bp
Strand : +
Note : identified by similarity to GB:AAD47288.1; match to protein family HMM PF02342

DNA sequence :
ATGGCTTTGACTCTGCAAAAAGGTGGCAACCTTTCGCTGTCGAAAACCGACCCTACCCTGACCAATGTACTGATTGGCCT
GGGCTGGGATCCGCGTGCCACTGACGGCCAGGAATTTGACCTGGACGCCAGCGCATTTCTGCTGGGCGCCAATGGCAAGG
TCCGCAGTGAAGCTGACTTCATTTTCTACAACCAGCTCAAGAGCGCCGATGGTTCCGTCGAACACACCGGTGACAACCGT
ACCGGTGCTGGTGATGGCGATGACGAAGTGCTCAAGGTCAATCTGACCAGCGTTCCTGCTGACGTGGACAAGATCGTCTT
CGTTGTGACCATTCACGACGCTGACAGCCGCAAGCAGAACTTCGGTCAGGTGGGCGGCTCGTTTATCCGTGTGCTGAATG
AAAAATCCAGCTCGGAAATCGTTCGCTACGACCTGGCGGAAGACGCCTCGACTGAAACCGCGATGATCTTCGCCGAGCTG
TATCGCAACAATGGCGAGTGGAAGTTCCGCGCAGTGGGTAGCGGCTTCGCCGGTGGCCTGAAAGCTGTGGCCAACTCTTT
CGGCATGAATTTCTGA

Protein sequence :
MALTLQKGGNLSLSKTDPTLTNVLIGLGWDPRATDGQEFDLDASAFLLGANGKVRSEADFIFYNQLKSADGSVEHTGDNR
TGAGDGDDEVLKVNLTSVPADVDKIVFVVTIHDADSRKQNFGQVGGSFIRVLNEKSSSEIVRYDLAEDASTETAMIFAEL
YRNNGEWKFRAVGSGFAGGLKAVANSFGMNF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-72 78
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-68 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-68 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-68 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-57 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-56 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-56 63
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_273118.1 tellurium resistance protein TerD BAC0389 Protein 7e-69 72
terD YP_273118.1 tellurium resistance protein TerD BAC0390 Protein 2e-60 65