Gene Information

Name : feuP (RPA1915)
Accession : NP_947260.1
Strain : Rhodopseudomonas palustris CGA009
Genome accession: NC_005296
Putative virulence/resistance : Virulence
Product : two-component transcriptional regulator FeuP
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2147990 - 2148664 bp
Length : 675 bp
Strand : +
Note : observed by proteomics; Citation: Proteomics from VerBerkmoes et al. (2003) unpublished

DNA sequence : 
GTGCGTCTGCTCGTCGTCGAAGATGACCCCGATCTCAACCGCCAGCTCACCACCGCGCTGACCGATGCCGGTTACGTGGT
CGACCGCGCCTTCGATGGCGAGGAGGGGCATTTCCTCGGCGACACCGAGCCGTACGACGCTGTCGTGCTCGACATCGGCC
TGCCGAAGATGGACGGCATCTCGGTGCTGGAAGCGTGGCGGCGCAACAGCCGCGCGATGCCGGTGCTGATCCTCACCGCG
CGCGACCGCTGGAGCGACAAGGTGCAGGGCTTCGACGCCGGCGCCGATGATTACGTCGCCAAGCCGTTCCATCTCGAGGA
AGTGCTGGCGCGGATCCGCGCGCTGCTGCGGCGGAGCGCCGGCCATGCGCAATCCGAGCTGACCTGCGGCCCGGTGGTGC
TCGACACCCGCACCGGCCGGGTCAGCGTCAGCGGCAATCCGGTGAAGCTGACCAGCCACGAATATCGGCTGCTCGCCTAT
CTGATGCACCACTCCGGCCGGGTGGTGTCGCGCACCGAGCTGGTCGAGCATCTGTACGATCAGGATTTCGACCGCGACAG
CAACACCATCGAGGTGTTCGTCGGCCGCATCCGCAAGAAGCTCGGCGTCGACATCATCCAGACCGTGCGCGGGCTCGGCT
ATCTGCTGTCGCCGCCGGCCGCGGACGCGCATTAG

Protein sequence : 
MRLLVVEDDPDLNRQLTTALTDAGYVVDRAFDGEEGHFLGDTEPYDAVVLDIGLPKMDGISVLEAWRRNSRAMPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHLEEVLARIRALLRRSAGHAQSELTCGPVVLDTRTGRVSVSGNPVKLTSHEYRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRKKLGVDIIQTVRGLGYLLSPPAADAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 5e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP NP_947260.1 two-component transcriptional regulator FeuP NC_002516.2.879194.p Protein 2e-41 49
feuP NP_947260.1 two-component transcriptional regulator FeuP CP000647.1.gene1136. Protein 5e-36 46
feuP NP_947260.1 two-component transcriptional regulator FeuP BAC0530 Protein 4e-36 46
feuP NP_947260.1 two-component transcriptional regulator FeuP CP001138.1.gene1939. Protein 1e-35 45
feuP NP_947260.1 two-component transcriptional regulator FeuP CP004022.1.gene1005. Protein 4e-38 45
feuP NP_947260.1 two-component transcriptional regulator FeuP NC_002695.1.913289.p Protein 4e-35 44
feuP NP_947260.1 two-component transcriptional regulator FeuP CP001918.1.gene2526. Protein 9e-35 44
feuP NP_947260.1 two-component transcriptional regulator FeuP CP000034.1.gene2022. Protein 1e-35 44
feuP NP_947260.1 two-component transcriptional regulator FeuP BAC0487 Protein 3e-30 44
feuP NP_947260.1 two-component transcriptional regulator FeuP BAC0347 Protein 7e-27 41
feuP NP_947260.1 two-component transcriptional regulator FeuP BAC0111 Protein 4e-31 41
feuP NP_947260.1 two-component transcriptional regulator FeuP BAC0125 Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP NP_947260.1 two-component transcriptional regulator FeuP VFG0475 Protein 1e-35 45
feuP NP_947260.1 two-component transcriptional regulator FeuP VFG0473 Protein 3e-28 41