Gene Information

Name : VVA1484 (VVA1484)
Accession : NP_937540.1
Strain :
Genome accession: NC_005140
Putative virulence/resistance : Virulence
Product : two component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1634462 - 1635157 bp
Length : 696 bp
Strand : +
Note : -

DNA sequence :
ATGAAACTTCTGATCATTGAAGACGAAAAGAAAACCGGGACGTATTTAAGAAAAGGACTTTCAGAAGCAGGCTATCTCGT
CAATCTCGCCTGCGATGGGGTTGATGGCCTCTATCAAGCCACCAGCCAGCGCTATGATTTAATTGTATTGGACGTGATGT
TGCCCCACCTCAATGGTTGGCAAGTGTTGCGCGCTCTGCGCAGTAGCCAAGTCGACACCCCAGTGATTCTGCTCACCGCA
CGCGACCAAGTCGAAGATCGAGTCAAAGGACTGGAGCTGGGCGCCGATGATTACATCGTTAAACCCTTCGCCTTTGTCGA
ACTGTTGGCGCGCATTCGCACCGTGCTCAAACGCCAGCAACCGACTACCCAAAGCACCACCCGGCTTTCCATCGCCAATC
TCCATCTGGACCTGTTGCGACGCAAAGTGTTTCGCGACAAAGAACCCATTGCCCTCACCGCCAAAGAGTTTGCCTTGTTG
GAGCTGTTTATGCGCAAAACGGGGGAAGTGATGTCGCGCAGCCAAATAGCCTCTTCCGTTTGGGACATGAATTTCGACAG
TGACACCAATGTCATCGACGTGGCCGTGCGGCGGCTGCGCAATAAAGTCGACAAACCGTTTGAGCCGAAATTGATTCACA
CTGAACGTGGCATGGGCTACGTGCTTGAGGAGCGAGAGCCTTGTTATGGGATTTAG

Protein sequence :
MKLLIIEDEKKTGTYLRKGLSEAGYLVNLACDGVDGLYQATSQRYDLIVLDVMLPHLNGWQVLRALRSSQVDTPVILLTA
RDQVEDRVKGLELGADDYIVKPFAFVELLARIRTVLKRQQPTTQSTTRLSIANLHLDLLRRKVFRDKEPIALTAKEFALL
ELFMRKTGEVMSRSQIASSVWDMNFDSDTNVIDVAVRRLRNKVDKPFEPKLIHTERGMGYVLEEREPCYGI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-61 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-60 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VVA1484 NP_937540.1 two component response regulator transcription regulator protein BAC0197 Protein 1e-68 63
VVA1484 NP_937540.1 two component response regulator transcription regulator protein BAC0083 Protein 9e-65 62
VVA1484 NP_937540.1 two component response regulator transcription regulator protein BAC0111 Protein 6e-66 60
VVA1484 NP_937540.1 two component response regulator transcription regulator protein BAC0308 Protein 4e-63 60
VVA1484 NP_937540.1 two component response regulator transcription regulator protein BAC0638 Protein 3e-59 60
VVA1484 NP_937540.1 two component response regulator transcription regulator protein BAC0125 Protein 3e-65 60
VVA1484 NP_937540.1 two component response regulator transcription regulator protein BAC0347 Protein 2e-57 54
VVA1484 NP_937540.1 two component response regulator transcription regulator protein HE999704.1.gene1528. Protein 4e-30 47
VVA1484 NP_937540.1 two component response regulator transcription regulator protein NC_013450.8614146.p0 Protein 3e-36 43
VVA1484 NP_937540.1 two component response regulator transcription regulator protein NC_002951.3238224.p0 Protein 3e-36 43
VVA1484 NP_937540.1 two component response regulator transcription regulator protein NC_007793.3914065.p0 Protein 3e-36 43
VVA1484 NP_937540.1 two component response regulator transcription regulator protein NC_002758.1121390.p0 Protein 3e-36 43
VVA1484 NP_937540.1 two component response regulator transcription regulator protein NC_010079.5776364.p0 Protein 3e-36 43
VVA1484 NP_937540.1 two component response regulator transcription regulator protein NC_002952.2859858.p0 Protein 3e-36 43
VVA1484 NP_937540.1 two component response regulator transcription regulator protein NC_007622.3794948.p0 Protein 3e-36 43
VVA1484 NP_937540.1 two component response regulator transcription regulator protein NC_003923.1003417.p0 Protein 3e-36 43
VVA1484 NP_937540.1 two component response regulator transcription regulator protein AE015929.1.gene1106. Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VVA1484 NP_937540.1 two component response regulator transcription regulator protein VFG0596 Protein 3e-61 59
VVA1484 NP_937540.1 two component response regulator transcription regulator protein VFG1390 Protein 7e-44 46
VVA1484 NP_937540.1 two component response regulator transcription regulator protein VFG1389 Protein 2e-36 43