Gene Information

Name : VV0810 (VV0810)
Accession : NP_933603.1
Strain :
Genome accession: NC_005139
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 813042 - 813236 bp
Length : 195 bp
Strand : +
Note : identified by GeneMark and Glimmer2

DNA sequence :
ATGAGATTTCTAAAGCTAAAAGAAGTAATGGAAAAGACAGCATTAAGCCGTTCAGCGATTTACCGCAAGATGAGTGACGG
AGAGTTTCCGCAATCAGTGAGTTTGGGCGATAGAGCTGTAGCTTGGGTGGAAAGTGAAGTACAAGACTGGGTGATTGATA
AGGTTGCTGAGCGCGATGAGCGAATAAGCACTTAA

Protein sequence :
MRFLKLKEVMEKTALSRSAIYRKMSDGEFPQSVSLGDRAVAWVESEVQDWVIDKVAERDERIST

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 7e-18 89
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 9e-18 89
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 9e-18 89
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 1e-13 55
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 2e-08 49
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 1e-12 47
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 2e-12 47
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 2e-12 47
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 2e-10 44
unnamed CAA21398.1 - Not tested HPI Protein 3e-10 44
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 1e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VV0810 NP_933603.1 transcriptional regulator VFG1118 Protein 3e-18 89
VV0810 NP_933603.1 transcriptional regulator VFG1141 Protein 5e-13 47