Name : VV0810 (VV0810) Accession : NP_933603.1 Strain : Genome accession: NC_005139 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 813042 - 813236 bp Length : 195 bp Strand : + Note : identified by GeneMark and Glimmer2 DNA sequence : ATGAGATTTCTAAAGCTAAAAGAAGTAATGGAAAAGACAGCATTAAGCCGTTCAGCGATTTACCGCAAGATGAGTGACGG AGAGTTTCCGCAATCAGTGAGTTTGGGCGATAGAGCTGTAGCTTGGGTGGAAAGTGAAGTACAAGACTGGGTGATTGATA AGGTTGCTGAGCGCGATGAGCGAATAAGCACTTAA Protein sequence : MRFLKLKEVMEKTALSRSAIYRKMSDGEFPQSVSLGDRAVAWVESEVQDWVIDKVAERDERIST |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 7e-18 | 89 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 9e-18 | 89 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 9e-18 | 89 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-13 | 55 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 2e-08 | 49 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-12 | 47 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-12 | 47 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-12 | 47 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 2e-10 | 44 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 3e-10 | 44 |
ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 1e-08 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
VV0810 | NP_933603.1 | transcriptional regulator | VFG1118 | Protein | 3e-18 | 89 |
VV0810 | NP_933603.1 | transcriptional regulator | VFG1141 | Protein | 5e-13 | 47 |