Name : VV0515 (VV0515) Accession : NP_933308.1 Strain : Genome accession: NC_005139 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 503386 - 503592 bp Length : 207 bp Strand : + Note : identified by GeneMark and Glimmer2 DNA sequence : GTGAAAATGAAATTTCTACGACTTAAAGACGTTATGTCACTAACAGGGCTAGGTCGCTCCACTATCTACAAGTTCATGGC TGATGAAACCGATTTTCCGAAGAGTGTCCCACTCGGTGGACGTGCCGTGGCTTGGGTCGAAAGTGAAATAGAGGAATGGA TGGAGCAACGTCTAGCACTGCGAGACAACCCAGAATCCTTTCAGTAA Protein sequence : MKMKFLRLKDVMSLTGLGRSTIYKFMADETDFPKSVPLGGRAVAWVESEIEEWMEQRLALRDNPESFQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 2e-24 | 93 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 9e-13 | 59 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-12 | 59 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-12 | 59 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 2e-07 | 50 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 4e-09 | 49 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 6e-09 | 49 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-13 | 49 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-13 | 49 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-13 | 49 |
ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 4e-07 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
VV0515 | NP_933308.1 | transcriptional regulator | VFG1118 | Protein | 4e-13 | 59 |
VV0515 | NP_933308.1 | transcriptional regulator | VFG1141 | Protein | 5e-14 | 49 |