
|
Name : VV2261 (VV2261) Accession : NP_935054.1 Strain : Genome accession: NC_005139 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 2280170 - 2280361 bp Length : 192 bp Strand : - Note : identified by GeneMark and Glimmer2 DNA sequence : ATGCCTAAACCAACTATACGTTTGATCCGTCTAAATGAAGTGCTTGGCATGACTGGCTTATCACGTTCTTGTATGTACCG CTTTATCGAAGCAAACCAGTTTCCGGCGCAAGTTCCGCTTGGTGGACGTGCTGTTGCTTGGGTAGAGAGTGAGGTGCAAG AGTGGGTCCGCCAGCGAGTACTAAACAGGTAA Protein sequence : MPKPTIRLIRLNEVLGMTGLSRSCMYRFIEANQFPAQVPLGGRAVAWVESEVQEWVRQRVLNR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-19 | 75 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-19 | 75 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 7e-19 | 74 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-12 | 54 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-10 | 49 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-10 | 49 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-10 | 49 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| VV2261 | NP_935054.1 | transcriptional regulator | VFG1141 | Protein | 1e-19 | 75 |
| VV2261 | NP_935054.1 | transcriptional regulator | VFG1118 | Protein | 1e-10 | 49 |