Gene Information

Name : VV2261 (VV2261)
Accession : NP_935054.1
Strain :
Genome accession: NC_005139
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2280170 - 2280361 bp
Length : 192 bp
Strand : -
Note : identified by GeneMark and Glimmer2

DNA sequence :
ATGCCTAAACCAACTATACGTTTGATCCGTCTAAATGAAGTGCTTGGCATGACTGGCTTATCACGTTCTTGTATGTACCG
CTTTATCGAAGCAAACCAGTTTCCGGCGCAAGTTCCGCTTGGTGGACGTGCTGTTGCTTGGGTAGAGAGTGAGGTGCAAG
AGTGGGTCCGCCAGCGAGTACTAAACAGGTAA

Protein sequence :
MPKPTIRLIRLNEVLGMTGLSRSCMYRFIEANQFPAQVPLGGRAVAWVESEVQEWVRQRVLNR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 4e-19 75
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 4e-19 75
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 7e-19 74
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 1e-12 54
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 3e-10 49
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 4e-10 49
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 4e-10 49

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VV2261 NP_935054.1 transcriptional regulator VFG1141 Protein 1e-19 75
VV2261 NP_935054.1 transcriptional regulator VFG1118 Protein 1e-10 49