Gene Information

Name : plu1023 (plu1023)
Accession : NP_928352.1
Strain : Photorhabdus luminescens TTO1
Genome accession: NC_005126
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1204058 - 1204360 bp
Length : 303 bp
Strand : +
Note : Highly similar to IS911

DNA sequence :
ATGATGAAAAGAAGTTTTAGCCCTGAATTCAAACTGGAATCCGCCCAGTTAGTCCTTGATCAAAATTACAGTGTTATGGA
AGCCGCTAAAGCGATGAATGTCAGCAAATCAGCCTTAGGGAGCTGGGTTCGTCAGTTGAGACAGGAGCGGCAAGGTAAAT
CTTCTAAAGCCATGCCCATCACGCCGGAGCAAATTGAAATACGTGAGCTGAAAAAGAAACTGCAACGTATTGAAATGGAA
AATGAAGTATTAAAAAAAGCTTCTGCACTCTTGATGTCGGACTACTTGAACAGTTCTCGTTAA

Protein sequence :
MMKRSFSPEFKLESAQLVLDQNYSVMEAAKAMNVSKSALGSWVRQLRQERQGKSSKAMPITPEQIEIRELKKKLQRIEME
NEVLKKASALLMSDYLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 76
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-30 76
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 76
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 76
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-30 76
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 76
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-30 76
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 76
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-32 75
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-32 75
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-27 73
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-31 72
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-27 66
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-25 61
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-25 61
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-24 60
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-24 60
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-24 60
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-24 60
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-21 53
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 7e-17 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-13 46
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-16 46
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 9e-13 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
plu1023 NP_928352.1 hypothetical protein VFG1123 Protein 4e-31 76
plu1023 NP_928352.1 hypothetical protein VFG1485 Protein 1e-32 75
plu1023 NP_928352.1 hypothetical protein VFG1553 Protein 4e-28 66
plu1023 NP_928352.1 hypothetical protein VFG0784 Protein 9e-25 60
plu1023 NP_928352.1 hypothetical protein VFG1566 Protein 1e-13 46
plu1023 NP_928352.1 hypothetical protein VFG1521 Protein 4e-13 45