Gene Information

Name : glr0860 (glr0860)
Accession : NP_923806.1
Strain : Gloeobacter violaceus PCC 7421
Genome accession: NC_005125
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 906514 - 907230 bp
Length : 717 bp
Strand : +
Note : -

DNA sequence :
GTGCCGCCGTCTCCGGGTGTAACCATGCCGAACGCCGCTATCCTCGTCGTCGAAGACGACCCGCTCATTCTTGAGACCAT
TCGCCGCTACCTCGAACACGCAGGGCACCGTTGCCATTGCGCCGCCGACGGTTGGGAGGCCGACCGGCTCGCCCTGCGCC
ACCGCCCGGATCTGGTGGTGCTCGACTGGATGCTGCCGGGCGTGGACGGTCTGGCGCTGTGCGAGCGCTGGCGCAAAGGG
GAGTACTTCGCGCCTGTGTTGATGCTCACGGCGCGCACCGAGGAGGACCACCGCGTGCGCGCTCTGGCGGGCGGGGCAGA
CGACTACCTGGACAAACCTTTCTCTGCAAAGGAACTGGTGGCCCGGGTGCAGGCCCTGCTGCGCCGCGCCTACGCCAGCG
GTTACCGCGACTGCAGCCCCAAAAACGGCCTGCTGGTCGATCGCAACACCCGTCAGGTGCAGCTGCACGGTCGCCCGATC
GACCTGCGGGCCCGGGAATTCGACCTGCTCGCCCAGTTGGCCGATCACCCCGGCCGGGTGTACTCGCGCGACGAACTGCT
CGAGCGGGTCTGGGGCTACGACTTCGAAGGCGGTCACCGGACGATCGACGTGCACGTGCGCAAGCTCCGCGAGAAGCTCG
AGCCGGATCCCACCCGCCCGGTCTATGTGCTCACCGTCTGGGGTGTGGGTTACAAATTCGCGGGACCGCCGCGGTGA

Protein sequence :
MPPSPGVTMPNAAILVVEDDPLILETIRRYLEHAGHRCHCAADGWEADRLALRHRPDLVVLDWMLPGVDGLALCERWRKG
EYFAPVLMLTARTEEDHRVRALAGGADDYLDKPFSAKELVARVQALLRRAYASGYRDCSPKNGLLVDRNTRQVQLHGRPI
DLRAREFDLLAQLADHPGRVYSRDELLERVWGYDFEGGHRTIDVHVRKLREKLEPDPTRPVYVLTVWGVGYKFAGPPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-36 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-36 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr0860 NP_923806.1 two-component response regulator AE000516.2.gene3505. Protein 1e-31 44
glr0860 NP_923806.1 two-component response regulator NC_012469.1.7685629. Protein 3e-37 43
glr0860 NP_923806.1 two-component response regulator AE016830.1.gene1681. Protein 9e-45 42
glr0860 NP_923806.1 two-component response regulator NC_008702.1.4607594. Protein 5e-32 42
glr0860 NP_923806.1 two-component response regulator BAC0487 Protein 1e-29 41
glr0860 NP_923806.1 two-component response regulator NC_002952.2859905.p0 Protein 8e-37 41
glr0860 NP_923806.1 two-component response regulator NC_003923.1003749.p0 Protein 8e-37 41
glr0860 NP_923806.1 two-component response regulator NC_002745.1124361.p0 Protein 9e-37 41
glr0860 NP_923806.1 two-component response regulator NC_009782.5559369.p0 Protein 9e-37 41
glr0860 NP_923806.1 two-component response regulator NC_002951.3237708.p0 Protein 9e-37 41
glr0860 NP_923806.1 two-component response regulator NC_007622.3794472.p0 Protein 8e-37 41
glr0860 NP_923806.1 two-component response regulator NC_002758.1121668.p0 Protein 9e-37 41
glr0860 NP_923806.1 two-component response regulator NC_009641.5332272.p0 Protein 9e-37 41
glr0860 NP_923806.1 two-component response regulator NC_013450.8614421.p0 Protein 9e-37 41
glr0860 NP_923806.1 two-component response regulator NC_007793.3914279.p0 Protein 9e-37 41
glr0860 NP_923806.1 two-component response regulator HE999704.1.gene2815. Protein 2e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr0860 NP_923806.1 two-component response regulator VFG1563 Protein 1e-36 45
glr0860 NP_923806.1 two-component response regulator VFG1702 Protein 3e-36 45
glr0860 NP_923806.1 two-component response regulator VFG1389 Protein 2e-30 45
glr0860 NP_923806.1 two-component response regulator VFG1390 Protein 3e-32 43