Gene Information

Name : glr4324 (glr4324)
Accession : NP_927270.1
Strain : Gloeobacter violaceus PCC 7421
Genome accession: NC_005125
Putative virulence/resistance : Resistance
Product : multidrug resistance protein EbrA-like protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 4557322 - 4557657 bp
Length : 336 bp
Strand : +
Note : -

DNA sequence :
GTGACTTTGCATCCGTTAATCCTGCTGGCTGTCGCCATCGCCAGCGAGGTGATCGGCTCCAGCGCGCTCAAATTGTCGGA
AGGTTTCAGCCGTCCCCTGCCAAGTTTGCTGGTAGTACTGGGCTACGGCGCAGCGTTTTACTTGCTGGGTCTGACCCTCA
AGGCGATGCCGCTGAGCGTGGTTTACGCCATCTGGTCCGGGGTGGGCACGGCGGCCACCGCCTTCATCGGCGTCGTTCTC
TTCCGCGAAGTACTCGACGCGCCCCGCCTGATCGGCATCGCCCTCATCATCGTTGGCGTGCTCGTCTTGAATCTTTCGGG
CGGCGGCCGCCTCTGA

Protein sequence :
MTLHPLILLAVAIASEVIGSSALKLSEGFSRPLPSLLVVLGYGAAFYLLGLTLKAMPLSVVYAIWSGVGTAATAFIGVVL
FREVLDAPRLIGIALIIVGVLVLNLSGGGRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-05 48
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-05 48
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-05 48
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 3e-05 48
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-05 48
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-05 48
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 3e-05 48
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-05 48
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 3e-05 48
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-05 48
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 3e-05 48
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-05 48
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-05 48
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 3e-05 48
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-05 48
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-05 48
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-05 48
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-05 48
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-05 48
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-05 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0139 Protein 4e-09 57
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0192 Protein 9e-09 55
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0002 Protein 7e-09 54
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein NC_010410.6003348.p0 Protein 7e-09 54
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0140 Protein 3e-08 50
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0377 Protein 3e-10 49
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0322 Protein 1e-05 48
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0323 Protein 9e-06 48
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0325 Protein 2e-07 45
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein CP004022.1.gene1549. Protein 6e-09 45
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein NC_002695.1.913273.p Protein 8e-06 44
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0150 Protein 8e-06 44
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0329 Protein 2e-07 44
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0321 Protein 2e-08 43
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0216 Protein 3e-04 43
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0327 Protein 5e-08 42
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein BAC0477 Protein 6e-06 42
glr4324 NP_927270.1 multidrug resistance protein EbrA-like protein CP001138.1.gene1489. Protein 6e-08 41